Dr. Zahra Babar Dermatologist Islamabad

Dr. Zahra Babar

Dermatologist

| MBBS | FCPS (Dermatology) | Certified Dermatologist (e-Derm) UK |

Consultant

3 Reviews

5 Yrs Experience

Get Confirmed Appointment Online

Select Hospital/Clinic

Video Consultation

Rs. 1,000

Available Today - 04:00 PM - 08:00 PM

Online

Elaaj Health Services

Rs. 1,500

Available from May 25 - 03:00 PM - 09:00 PM

PWD
Select Date & Time

Book now and get contact details and address location in SMS.

3 Reviews

5/5 Average rating based on 3 reviews.

Wait Time

10 mins

Avg. Time to Patient

12 mins

Patient Satisfaction
5/5
Diagnosis
5/5
Staff Behaviour
5/5
Clinic Environment
5/5

A - 17/12/2023

I am satisfied with the doctor.

  • 10 min wait time
  • Great Experience
  • Good PA / Saff
  • Good Clinic
  • 10 min meetup

Elaaj Health Services


A.k - 07/08/2023

I am satisfied with the doctor.

  • Less Than 10 mins wait time
  • Great Experience
  • 5 min meetup

Video Consultation


M.H - 24/09/2022

I am satisfied with the doctor.

  • 10 min wait time
  • Great Experience
  • Good PA / Saff
  • Good Clinic
  • 20 min meetup

Elaaj Health Services


Practice Address and Timings

Patient Questions from Dr. Zahra Babar

Asking for Self, Female, 27 years old

Skin Issue

I have been receiving eczema treatment from 12 years. Last month I went to NIH and doen my skin prick test. it showed protein allergy instead of eczema. I have stopped all form of protein but still my symptoms are mot improving. Al...

Asking For Self, Female, 30 Years old

Face Burn

Aoa please help me urgently, my face burn due to bleaching.. bohat buri tarah . Mera kabi face pa aisa reaction nai howa pehly, facial karwna tha bleach lagaty he react kar gai .. last night bas redness thi aj redness waisay he hai...

Asking For Self, Female 25

Hair Growth Stuck

Mee baal dry and rough Hai or hair growth bi stuck hogai h low prosity hair hain hr chez lgalo farq nh prhta what can I do pls suggest

Qualification

Institute Degree
University of Health Sciences, Lahore MBBS
NHS Health Education England, UK e-Dermatology
College of Physicians and Surgeons Pakistan, Karachi FCPS (Dermatology)

Experience

Institute Designation
THQ, Kahuta WMO
Elaaj Health Services, Islamabad Consultant Dermatologist

FAQs

You can contact the Dermatologist through Marham's helpline: 0311-1222398 and we'll connect you with Dr. Zahra Babar

Dr. Zahra Babar has the following degrees : | MBBS | FCPS (Dermatology) | Certified Dermatologist (e-Derm) UK |

Dr. Zahra Babar is specialist Dermatologist. Her area of expertise include Hair Problems, Acne, Skin Problems, Cosmetic Treatment


Video Consultation


Monday

  • 04:00 PM - 08:00 PM

Tuesday

  • 04:00 PM - 08:00 PM

Wednesday

  • 04:00 PM - 08:00 PM

Thursday

  • 04:00 PM - 08:00 PM

Friday

  • 04:00 PM - 08:00 PM

Saturday

  • 04:00 PM - 08:00 PM


Elaaj Health Services


Saturday

  • 03:00 PM - 09:00 PM

Sunday

  • 03:00 PM - 09:00 PM

Interest

  • Hair Problems
  • Acne
  • Skin Problems
  • Cosmetic Treatment

Professional Statement by Dr. Zahra Babar


Dr. Zahra Babar - Dermatologist, Islamabad - Appointment Details:

Dr. Zahra Babar is a qualified Dermatologist in Islamabad with over 5 years of experience in the field. With numerous qualifications, the doctor provides the best treatment for all Dermatologist related diseases. Dr. Zahra Babar has treated over 6 patients through Marham and has 3 reviews. You can book an appointment with Dr. Zahra Babar through Marham.


Role of Dermatologist:
Skin specialists like Dr. Zahra Babar help in the treatment of all diseases related to the skin hair and nails. Other commonly used names for a Dermatologist are skin care specialist, aesthetician, and skin doctor. They can care for people of all ages from babies to adults.
Some of the common roles of a dermatologist are the diagnosis and treatment of all skin-related diseases and disorders whether minor or major. You can also get cosmetic procedures done from skin specialists like hydra facials, wrinkle treatment, mole removal, or acne scar treatments, etc.


Qualifications: MBBS from University of Health Sciences, Lahore, e-Dermatology from NHS Health Education England, UK and FCPS (Dermatology) from College of Physicians and Surgeons Pakistan, Karachi


Experience:
Dr. Zahra Babar has been treating patients with Dermatologist related diseases for the past 5 years and has an excellent success rate.


Patient Satisfaction Score:
Dr. Zahra Babar has an impressive 100% and has received great reviews from Marham Users. Most of the patients are happy with the quality of treatment Dr. Zahra Babar provides and recommend them for the treatment of dermatological issues.


Special interests of Dr. Zahra Babar:
The special interests of Dr. Zahra Babar are:

  • Hair Problems
  • Acne
  • Skin Problems
  • Cosmetic Treatment

Dr. Zahra Babar Appointment Details:
Dr. Zahra Babar, the Dermatologist, is available for Marham's in-person and online video consultation.

Dr. Zahra Babar‘s PWD, Islamabad:

PWD, Islamabad

Dr. Zahra Babar‘s clinic timings are 03:00 PM - 09:00 PM.

You can contact Dr. Zahra Babar at 042-32591427.


Dr. Zahra Babar's Fee
Dr. Zahra Babar charges a fee of PKR 1,000; you can book your appointment now by calling 042-32591427

Get Affordable Care from Dermatologists -- Upto Rs. 1000 in Lahore

dr-fauzia-arshad-spid67specialitydermatologistspeciality-imagedermatologisttitledermatology-cosmetologytitle-2skinslugdermatologistdetailthe-specialists-who-treat-skin-problems-are-called-dermatologists-or-skin-specialistscausesspecialitysoundextrmtljsturdu-nameu0645u0627u06c1u0631-u0627u0645u0631u0627u0636-u062cu0644u062fparent3parent-slugdermatologist-cosmetologistseo-h1doctorscount-best-gender-dermatologist-skin-specialist-in-area-cityseo-h2dermatologist-skin-specialist-city-descriptionseo-titlebest-gender-certified-dermatologist-verified-skin-doctors-in-area-city-marhamseo-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-areaseo-page-descriptionp-styletext-align-justifyabove-is-the-list-of-strongpmc-pakistan-medical-commission-verified-gender-dermatologists-in-citystrong-you-can-view-their-experience-practice-locations-timings-services-fees-and-patient-reviews-you-can-also-find-the-best-dermatologists-in-city-on-the-basis-of-area-fee-gender-and-availability-more-than-doctorscount-top-dermatologists-of-city-are-listed-here-strongbook-an-appointmentstrong-or-strongconsult-onlinestrongph3-styletext-align-justifywho-is-a-dermatologisth3p-styletext-align-justifygender-dermatologists-are-doctors-who-treat-and-diagnose-the-istrongssues-that-affect-our-hair-skinstrong-and-nails-moreover-strongdermatologists-also-deal-with-mucous-membranes-the-tissue-that-lines-your-nose-mouth-and-also-eyelidsstrongph3-styletext-align-justifygender-dermatologists-diagnose-and-treat-the-following-skin-issuesh3ulli-styletext-align-justifystrongacnestronglili-styletext-align-justifyskin-rasheslili-styletext-align-justifydull-complexionlili-styletext-align-justifydiscolorationlili-styletext-align-justifypigmentationlili-styletext-align-justifyvarious-allergies-and-blood-disorders-with-diabeteslili-styletext-align-justifystronghair-fallstronglili-styletext-align-justifystrongdandruffstrongliulp-styletext-align-justifyapart-from-these-issues-stronggender-dermatologistsstrong-also-recognize-and-diagnose-symptoms-of-various-underlying-health-issues-ie-diabetes-has-an-impact-on-the-strongskin-appearancestrong-and-a-dermatologist-might-be-the-first-one-to-diagnose-itpp-styletext-align-justifystrongtheir-work-splits-into-these-three-branchesstrongpulli-styletext-align-justifystrongmedicalstrong-gender-dermatologists-work-on-the-diagnosis-and-treatments-of-the-conditions-that-affect-our-skinlili-styletext-align-justifystrongsurgerystrong-they-also-do-minor-surgeries-to-remove-moles-or-wartslili-styletext-align-justifystrongcosmeticstrong-they-also-deal-with-all-those-issues-that-affect-our-appearances-ie-hair-loss-dark-spots-and-wrinklesliulh3-styletext-align-justifywhen-to-see-a-dermatologisth3p-styletext-align-justifydermatologists-deal-with-various-issues-that-affect-the-skin-hair-or-nails-you-should-visit-a-stronggender-dermatologist-every-six-to-eight-monthsstrong-in-case-you-experience-the-following-symptoms-you-should-see-a-gender-dermatologist-immediatelypulli-styletext-align-justifyskin-rasheslili-styletext-align-justifyskin-irritationburninglili-styletext-align-justifyitchy-and-flaky-skinlili-styletext-align-justifyacnelili-styletext-align-justifystrongskin-blemishesstronglili-styletext-align-justifystrongskin-discolorationstronglili-styletext-align-justifystrongmoles-warts-and-other-growth-on-the-skinstronglili-styletext-align-justifystrongvaricose-veinsstronglili-styletext-align-justifystrongwrinkles-sun-damage-and-sagging-skinstronglili-styletext-align-justifystronghair-damagestronglili-styletext-align-justifyhair-falllili-styletext-align-justifydandrufflili-styletext-align-justifyfingernail-or-toenail-issuesliulh3-styletext-align-justifywhat-issues-are-treated-by-dermatologists-in-cityh3p-styletext-align-justifygender-dermatologists-treat-all-the-health-issues-that-relate-to-our-skin-hair-and-nails-moreover-they-provide-a-wide-range-of-services-and-also-treat-the-following-issuespulli-styletext-align-justifybiopsies-they-do-different-types-of-biopsies-to-diagnose-or-cross-check-the-symptoms-of-skin-cancers-and-other-conditionslili-styletext-align-justifystronglaser-therapystrong-they-use-laser-treatments-to-remove-warts-moles-sun-spots-tattoos-acne-scars-blemishes-wrinkles-and-unwanted-hairlili-styletext-align-justifysurgical-procedures-they-do-surgical-procedures-to-remove-moles-tags-on-the-skin-and-lesionslili-styletext-align-justifysclerotherapy-they-perform-this-procedure-to-treat-spider-and-varicose-veinslili-styletext-align-justifystrongmohs-surgerystrong-this-treatment-removes-a-thin-tissue-layer-around-a-tumorlili-styletext-align-justifychemical-peels-this-procedure-works-wonders-on-our-face-to-remove-the-dead-and-damaged-skinlili-styletext-align-justifystrongcosmetic-injectionsstrong-these-injections-help-diminish-the-wrinkly-and-sagging-skinlili-styletext-align-justifydermabrasion-dermatologists-use-this-technique-to-reduce-the-appearance-of-fine-lines-strongage-spotsstrong-and-strongacne-scarsstronglili-styletext-align-justifytumescent-liposuction-dermatologists-use-liposuction-treatment-for-the-removal-of-unwanted-fat-from-targeted-areas-of-our-bodyliulp-styletext-align-justifyyou-should-strongbook-an-appointment-or-online-consultation-with-the-best-gender-dermatologists-in-citystrong-if-you-face-any-of-the-issues-mentioned-aboveph3-styletext-align-justifywhat-types-of-dermatologists-are-thereh3p-styletext-align-justifyfollowing-are-the-four-main-types-of-gender-dermatologistspulli-styletext-align-justifydermatopathologists-the-ones-who-work-on-the-root-causes-of-the-origin-of-strongvarious-skin-diseasesstronglili-styletext-align-justifystrongpediatric-dermatologistsstrong-these-dermatologists-work-specifically-with-strongskin-issues-in-childrennbspstrongunder-12-years-of-agelili-styletext-align-justifyimmunodermatologists-such-dermatologists-focus-on-examining-how-the-immune-system-interacts-with-our-skin-and-skin-manifestation-of-various-autoimmune-diseaseslili-styletext-align-justifystrongcosmetic-dermatologistsstrong-unlike-immunodermatologists-these-strongtypes-of-dermatologistsstrong-are-the-most-common-ones-that-we-can-find-in-the-field-of-dermatologyliulh3-styletext-align-justifywhat-is-the-qualification-of-a-dermatologisth3p-styletext-align-justifyin-pakistan-stronggender-dermatologistsstrong-are-mbbs-doctors-who-complete-their-five-years-of-study-in-a-medical-college-after-this-gender-dermatologists-become-fellow-of-the-college-of-physicians-and-surgeons-pakistan-fcps-in-their-respective-specialty-all-the-gender-dermatologists-are-pmc-pakistan-medical-commission-verified-however-many-stronggender-dermatologistsstrong-go-on-to-further-specialize-from-abroad-such-as-caaam-d-dermatology-and-othersph3-styletext-align-justifywhat-things-you-should-keep-in-mind-while-selecting-a-dermatologisth3p-styletext-align-justifybefore-choosing-a-gender-dermatologist-you-need-to-think-very-carefully-and-evaluate-your-options-on-the-following-basispulli-styletext-align-justifyexperience-of-the-gender-dermatologistlili-styletext-align-justifyservices-of-the-gender-dermatologist-that-whether-the-gender-dermatologist-provides-the-service-you-are-looking-for-or-notlili-styletext-align-justifyqualifications-of-the-gender-dermatologist-you-should-see-how-qualified-the-gender-dermatologist-islili-styletext-align-justifystrongreviews-of-the-patientsstrong-you-should-read-the-patientrsquos-feedback-this-will-help-you-in-making-an-informed-decision-for-gender-dermatologists-to-seeliulh3-styletext-align-justifywho-are-the-best-gender-dermatologists-in-cityh3p-styletext-align-justifyon-the-basis-of-experience-reviews-and-patients39-feedback-we-have-shortlisted-the-strongtop-five-gender-dermatologists-in-citystrong-their-names-are-as-followspptopdoctorofspecialityph3-styletext-align-justifybook-appointment-or-consult-online-through-marhampkh3p-styletext-align-justifyyou-can-strongbook-an-appointment-or-online-video-consultationstrong-with-the-strongbest-dermatologists-in-city-through-marhampkstrong-pakistanrsquos-no1-healthcare-platform-you-can-book-your-appointment-online-or-call-our-helpline-03111222398-marham-has-so-far-helped-10-million-patients-to-book-their-appointments-with-verified-doctors-we-are-the-largest-service-providing-startup-in-pakistan-stronggoogle-and-facebook-have-awarded-marham-in-recognition-of-its-servicesstrongpp-styletext-align-justifywe-have-registered-the-strongbest-gender-dermatologists-in-citystrong-on-our-platform-now-you-can-avail-the-strongbest-healthcarestrong-with-ease-and-comfort-patients-reviews-practice-details-experience-timing-slots-are-available-to-make-it-easier-for-you-to-strongbook-an-appointmentstrong-you-can-also-consult-online-with-the-strongbest-gender-dermatologists-in-citystrong-and-discuss-your-issues-via-audiostrongvideo-callstrongpp-styletext-align-justifycontent-reviewed-by-a-hrefhttpswwwmarhampkdoctorslahoredermatologistdr-saleha-zeeshandr-saleha-zeeshan-dermatologistapseo-keywordsskin-specialist-skin-doctor-cosmetic-surgeon-aesthetic-physician-cosmetologist-u0645u0627u06c1u0631-u0627u0645u0631u0627u0636-u062cu0644u062fonline-consultation-videohttpswwwyoutubecomwatchv8vapchlro8wposition2redirect-tonullfaqsquestionwhat-is-the-fee-of-a-dermatologist-in-cityanswerpthe-fee-for-a-dermatologist-in-city-generally-ranges-between-rs-strongfeerangestrongpquestionwho-are-the-top-reviewed-dermatologists-in-cityanswerpthe-following-are-the-top-reviewed-dermatologists-in-citypptoprevieweddoctorspquestionwho-are-the-most-experienced-dermatologists-in-cityanswerpthe-following-are-the-most-experienced-dermatologists-in-cityppmostexperienceddoctorspquestionhow-to-book-an-appointment-with-a-dermatologist-in-cityanswerpyou-can-book-an-appointment-with-a-dermatologist-by-visiting-the-doctorrsquos-profile-or-by-calling-our-marham-helpline-at-strong03111222398strongpquestiondo-i-have-to-pay-extra-charges-if-i-book-a-dermatologist-consultation-via-marhampkanswerpno-you-donrsquot-have-to-pay-any-extra-charges-if-you-book-a-dermatologist-consultation-via-marhampkpquestionwhat-are-the-payment-methods-for-online-consultationanswerpyou-can-use-any-of-the-following-payment-methodspullibank-transferlilicredit-cardlilieasy-paisa-or-jazz-cashliulquestiondo-you-have-a-dermatologist-under-1000-in-cityanswerpmarham-has-affordable-dermatologists-whom-you-can-consult-for-under-rs-1000-here39s-the-listpplessthanthousanddoctorspactionsis-pmdc-mandatory-1-is-doctor-prefix-required-1algo-status0algo-updated-at2022-08-17t094603000000zalgo-updated-by639669seo-contentlisting-h1doctorscount-best-dermatologist-in-city-top-skin-specialistslisting-h2what-is-dermatologylisting-titledoctorscount-best-dermatologist-in-city-top-skin-specialist-marhamlisting-area-h1doctorscount-best-gender-dermatologist-in-area-city-top-skin-specialistlisting-area-h2best-dermatologist-in-area-citylisting-gender-h1doctorscount-best-gender-dermatologistskin-specialist-in-area-citylisting-gender-h2gender-dermatologist-in-city-introductionlisting-area-titledoctorscount-best-gender-dermatologist-in-area-city-top-skin-specialist-marhamlisting-gender-titlebest-gender-dermatologist-in-area-city-top-skin-specialist-marhamlisting-gender-area-h1doctorscount-best-gender-dermatologist-skin-specialist-in-area-citylisting-gender-area-h2gender-dermatologist-in-area-city-introductionlisting-meta-descriptionmarham-can-help-you-find-a-dermatologist-in-city-for-your-skin-care-book-an-appointment-with-the-top-skin-specialist-near-you-based-on-their-experience-and-patient-reviewslisting-page-descriptionpa-dermatologist-is-a-medical-doctor-who-specializes-in-medicine-and-further-specializes-in-diagnosing-and-treating-hair-skin-nails-and-mucus-membrane-diseases-some-dermatologists-specializing-in-derma-surgery-are-known-as-dermatologist-surgeonsnbspppthey-are-highly-trained-physicians-who-are-extensively-trained-in-accurately-diagnosing-and-properly-treating-skin-hair-and-nail-related-diseases-they-can-also-manage-cosmetic-disorders-such-as-scars-hair-loss-etcnbspppdermatologists-treat-more-than-3000-skin-hair-and-nail-diseases-as-well-as-cosmetic-concernsnbspph2strongwhat-is-dermatologystrongh2pdermatology-is-the-branch-of-medicine-that-involves-researching-studying-diagnosing-managing-and-treating-conditions-that-affect-the-skin-nails-hair-and-mucus-membranesppit-is-a-specialty-having-both-medical-and-surgical-aspects-the-people-who-study-and-specialize-in-dermatology-and-skin-related-diseases-are-known-as-dermatologistsnbspph2strongalternative-names-for-a-dermatologist-in-citystrongh2psome-of-the-alternative-names-of-a-dermatologist-in-city-are-as-followspulli-dirltrpskin-specialistplili-dirltrpskin-doctorplili-dirltrpcosmetologistplili-dirltrpaesthetic-physicianpliulh2strongwhen-to-see-a-dermatologiststrongh2pyou-should-see-a-dermatologist-to-treat-all-if-you-notice-any-of-the-following-symptoms-or-issuespulli-dirltrpif-you-have-dry-itchy-skin-or-scalpplili-dirltrpif-you-have-any-kind-of-skin-allergiesplili-dirltrpif-you-have-skin-growths-such-as-warts-moles-or-cystsplili-dirltrpif-you-are-facing-hair-damage-or-hair-lossplili-dirltrpif-you-have-any-irregular-skin-growthsplili-dirltrpif-you-have-skin-discolorationplili-dirltrpif-you-have-lesions-or-asymmetrical-molesplili-dirltrpif-you-are-experiencing-frequent-acneplili-dirltrpif-you-are-having-excessive-dandruffplili-dirltrpif-you-are-dealing-with-stubborn-acne-or-acne-marksplili-dirltrpif-you-have-anything-like-nail-abnormalitiesplili-dirltrpif-you-have-unusual-bumps-or-lumps-on-any-part-of-the-skinplili-dirltrpif-you-have-burns-scars-or-acne-marksnbsppliulpif-you-are-facing-any-of-these-conditions-or-any-other-skin-related-issues-then-consult-the-best-dermatologist-in-pakistan-rather-than-ignoring-these-or-doing-any-diysnbspppmoreover-you-can-also-consult-a-dermatologist-if-you-want-any-cosmetic-treatments-to-improve-the-look-tone-and-texture-of-your-skinnbspph2strongwhat-are-the-main-areas-of-concern-for-a-dermatologiststrongh2psome-of-the-main-areas-of-concern-for-a-dermatologist-are-as-followspullidiagnosing-the-skin-hair-or-nails-related-conditionslilitreating-and-managing-those-areas-of-concern-like-eczema-acne-acne-scarsliliprescribing-medicines-ointments-creams-etc-to-overcome-the-derma-issuelilimaking-cosmetic-improvements-to-the-patientrsquos-issue-via-various-procedures-including-chemical-peels-dermabrasion-etcliulh2strongwhat-services-do-dermatologists-providestrongh2phere-are-some-of-the-services-that-a-skin-specialist-can-providepulli-dirltrpstrongdiagnosis-and-treatmentstrongpliulpprofessional-dermatologists-diagnose-and-treat-any-of-the-hair-skin-nails-and-mucus-membrane-diseases-they-perform-thorough-screening-tests-and-diagnosis-to-determine-the-perfect-treatment-for-the-problempulli-dirltrpstrongcosmetic-proceduresstrongpliulpdermatologists-also-perform-various-cosmetic-procedures-including-dermal-fillers-botox-injections-chemical-peels-etcnbsppulli-dirltrpstrongsurgical-proceduresstrongpliulpthey-also-perform-surgical-procedures-to-treat-any-severe-condition-that-cannot-be-treated-with-any-normal-cosmetic-procedures-surgical-procedures-include-skin-biopsy-mole-removal-cyst-removal-etcnbsppulli-dirltrpstrongmanagement-of-chronic-conditionsstrongpliulpdermatologists-also-manage-several-chronic-conditions-including-vitiligo-and-rosaceanbsppulli-dirltrpstronggive-advicestrongpliulpdermatologists-also-provide-advice-on-skincare-routines-products-and-other-diy-things-for-various-skin-conditions-and-typesph2strongwhat-conditions-does-a-dermatologist-treatstrongh2pdermatologists-can-diagnose-and-treat-hundreds-of-conditions-related-to-hair-skin-nails-and-mucus-membranes-includingpulli-dirltrpa-hrefhttpswwwmarhampkall-diseaseseczemastrongeczemastrongastrongnbspstrongpliulpa-nbspdisease-condition-that-makes-your-skin-red-and-itchy-and-is-treated-by-your-dermatologist-using-ointments-and-creamspulli-dirltrpa-hrefhttpswwwmarhampkall-diseasespimplesstrongpimplenbspstrongapliulpthey-are-small-pustules-that-are-raised-on-the-skin-due-to-excessive-sebum-production-and-dust-which-are-routinely-managed-by-a-dermatologist-based-on-the-severity-of-the-skin-conditionpulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesdandruffstrongdandruffstrongapliulpmany-people-around-the-world-face-dandruff-issues-it-causes-the-skin-on-the-scalp-to-flake-it-is-not-a-serious-or-contagious-condition-however-it-is-difficult-to-treat-and-can-be-embarrassingpulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesmelasmastrongmelasmastrongapliulpmelasma-is-a-skin-problem-that-is-caused-by-brown-to-gray-brown-patches-on-the-skin-of-the-face-mostly-it-affects-the-chin-cheeks-nose-bridge-forehead-above-the-upper-lip-etc-it-is-more-common-in-women-as-compared-to-men-the-most-common-cause-of-melasma-is-pregnancynbsppullia-hrefhttpswwwmarhampkall-diseasesskin-cancerstrongskin-cancerstrongaliulpskin-cancer-is-the-uncontrolled-division-of-abnormal-cells-in-the-outermost-layer-of-the-skin-it-is-caused-by-unrepaired-dna-damage-that-triggers-mutation-surgical-dermatologist-treats-skin-cancer-via-surgical-interventions-radiation-therapy-immunotherapy-chemotherapy-etcnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesacnepakistanstrongacnestrongastrongnbspstrongpliulpacne-resulting-from-clogged-hair-follicles-by-oil-dirt-or-dead-cells-is-evaluated-by-a-dermatologist-who-then-prescribes-suitable-topical-remediespulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesingrown-nailsstrongingrown-nailsstrongapliulpingrown-nails-is-the-toe-condition-when-the-corner-of-the-toenail-grows-down-into-the-skin-dermatologists-can-treat-all-nails-related-issues-including-fungal-nails-clubbing-changes-in-the-thickness-of-nails-nail-discoloration-etcpulli-dirltrpa-hrefhttpswwwmarhampkall-serviceshair-restorationlahorestronghair-lossstrongastrongnbspstrongpliulpit-is-a-common-issue-in-young-people-nowadays-and-also-in-older-adults-a-dermatologist-provides-treatment-for-hair-loss-using-injections-medicines-and-laser-therapypulli-dirltrpa-hrefhttpswwwmarhampkall-diseaseswartsstrongwartstrongastrongnbspstrongpliulpyour-skin-doctor-provides-peeling-medicines-or-removes-the-skin-outgrowths-and-moles-through-surgical-excision-they-also-help-to-prevent-fungal-infections-causing-such-conditionspulli-dirltrpa-hrefhttpswwwmarhampkall-diseasespsoriasisstrongpsoriasisstrongastrongstrongpliulppsoriasis-is-an-autoimmune-disease-that-causes-itchy-red-patches-on-the-skin-as-this-disease-is-an-autoimmune-disease-therefore-it-is-chronic-however-dermatologists-can-prescribe-medicines-injections-and-therapies-to-manage-the-symptomsnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-servicesremoval-of-moles-wartsstrongmolesstrongapliulpmoles-are-brown-or-black-growths-on-the-skin-that-are-normally-harmless-and-form-in-childhood-and-adolescence-a-dermatologist-can-remove-moles-by-implementing-surgical-procedures-or-other-treatment-optionsnbsppulli-dirltrpstrongdermatitisnbspstrongpliulpa-dermatologist-treats-red-itchy-rash-and-inflamed-skin-by-prescribing-skin-creams-and-moisturizerspulli-dirltrpstrongathletersquos-foot-tinea-pedisstrongpliulpathletersquos-foot-is-a-fungal-skin-condition-that-begins-between-the-toes-it-is-an-infection-that-causes-white-patches-between-the-toes-skin-specialists-recommend-ointments-tablets-and-creams-to-treat-this-conditionnbspph2strongwhat-are-common-procedures-performed-by-a-dermatologiststrongh2ulli-dirltrpa-hrefhttpswwwmarhampkall-servicesskin-whiteningstrongskin-whiteningstrongapliulpthis-procedure-can-help-to-lighten-dark-spots-and-blemishes-on-the-skin-it-functions-by-reducing-the-production-and-concentration-of-melanin-in-the-skin-it-is-also-used-to-lighten-the-overall-skin-tone-of-a-personnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-servicesrf-for-skin-tighteningstrongskin-tighteningstrongapliulpskin-tightening-can-help-to-reduce-the-appearance-of-wrinkles-and-sagging-skin-it-is-also-used-to-do-face-slimming-and-to-improve-the-skin-elasticitynbsppulli-dirltrpa-hrefhttpswwwmarhampkall-diseasespsoriasisstrongpsoriasis-treatmentstrongapliulpthis-condition-causes-red-scaly-patches-on-the-skin-a-dermatologist-can-prescribe-medications-or-recommend-other-treatments-to-help-manage-psoriasis-certain-ointments-topical-corticosteroids-and-steroid-creams-are-commonly-prescribed-to-treat-mild-to-moderate-psoriasis-this-treatment-functions-by-reducing-inflammation-by-slowing-the-production-of-skin-cells-and-lessening-itchingpulli-dirltrpa-hrefhttpswwwmarhampkspecial-offerslaser-hair-removal-68stronglaser-hair-removalstrongapliulpthis-procedure-can-inhibit-or-delay-the-growth-of-the-unwanted-hair-in-this-procedure-the-laser-is-applied-to-the-area-from-where-you-want-to-remove-any-unwanted-hairnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesrosaceapakistanstrongrosacea-treatmentstrongapliulpthis-condition-causes-redness-flushing-and-pimples-on-the-face-a-dermatologist-can-prescribe-medications-or-recommend-other-treatments-to-help-manage-rosaceapulli-dirltrpa-hrefhttpswwwmarhampkall-servicesdermal-fillerstrongdermal-fillersstrongapliulpdermal-fillers-are-commonly-used-by-cosmetic-facial-surgeons-to-lessen-the-signs-of-aging-minimize-skin-scars-and-depressions-and-treat-fine-lines-and-deep-wrinkles-these-injections-can-fill-in-wrinkles-and-other-facial-folds-they-can-also-be-used-to-fill-in-the-hollow-areas-under-the-eyespulli-dirltrpa-hrefhttpswwwmarhampkall-serviceshair-transplantstronghair-transplantationstrongapliulpthis-procedure-can-be-used-to-restore-hair-loss-for-hair-transplantation-there-are-various-techniques-but-all-hair-transplantations-involve-taking-hair-from-one-part-of-the-scalp-and-grafting-those-hair-onto-bald-or-thin-areas-of-the-scalpppsome-of-the-strongother-proceduresnbspstrongcommonly-performed-by-a-dermatologist-are-as-followspulli-dirltrpchemical-peelsplili-dirltrphydrafacialplili-dirltrpmedicated-facialsplili-dirltrpmicroneedlingplili-dirltrpcryosurgeryplili-dirltrpmohs-surgeryplili-dirltrpmicrodermabrasionpliulh2strongwhat-are-the-most-common-skin-diseases-in-pakistanstrongh2pdermatologists-can-treat-over-em3000nbspemskin-nails-and-hair-related-diseases-the-most-common-ones-are-as-followspulliacne-vulgarisliliscabiesliliimpetigolilieczema-atopic-dermatitisliliseborrheic-dermatitislilifolliculitisliliurticarianbsplilifungal-infections-ringwormlilipsoriasislilivitiligolilimelasmaliliskin-cancerlilitinea-pedis-athletersquos-footliulh2stronghow-to-prepare-for-a-visit-to-a-dermatologiststrongh2pbefore-visiting-a-dermatologist-one-should-keep-the-following-things-in-mindpulli-dirltrpmake-a-list-of-your-issues-and-concerns-or-any-symptoms-that-you-have-noticedplili-dirltrpif-you-have-any-medical-history-then-make-sure-to-keep-the-documents-prescriptions-etcplili-dirltrplist-down-all-the-supplements-medications-or-any-topical-products-that-you-are-usingplili-dirltrpmake-sure-that-your-skin-is-clean-and-free-of-makeupplili-dirltrpdescribe-your-skincare-routine-including-products-and-frequency-of-useplili-dirltrpavoid-wearing-nail-polish-before-visiting-a-dermatologistplili-dirltrpshare-your-family-medical-history-otc-products-etc-with-the-doctorplili-dirltrpwear-comfortable-clothes-so-that-it-is-easy-for-the-doctor-to-access-and-examine-the-affected-skin-areasplili-dirltrpprepare-a-list-of-questions-or-concerns-that-you-want-to-discuss-with-the-dermatologistplili-dirltrptake-pictures-of-the-areas-that-you-cannot-show-to-the-doctor-before-the-visitpliulh2strongwhat-are-some-diagnostic-techniques-used-by-dermatologistsstrongh2pnormally-dermatologists-perform-a-physical-examination-of-the-affected-area-to-diagnose-any-condition-the-doctor-may-prescribe-some-additional-tests-biopsies-skin-cultures-patch-tests-etc-to-accurately-diagnose-the-diseasenbspppsome-of-the-common-diagnostic-methods-performed-and-recommended-by-a-dermatologist-are-as-followspulli-dirltrpstrongvisual-examinationstrongpliulpone-of-the-basic-and-common-ways-of-diagnosing-a-condition-is-the-visual-physical-examination-of-the-affected-area-the-doctor-may-look-for-any-rashes-lesions-lumps-scars-etcnbsppulli-dirltrpstrongskin-culturestrongpliulpthis-test-is-used-to-identify-the-bacteria-or-fungus-that-is-causing-an-infectionpulli-dirltrpstrongskin-biopsystrongpliulpthis-technique-enables-an-in-depth-cellular-level-diagnosis-in-this-procedure-a-small-sample-of-the-skin-tissue-is-removed-and-examined-under-a-microscope-to-diagnose-various-skin-conditions-including-inflammatory-disorders-skin-cancer-and-infectionspulli-dirltrpstrongpatch-teststrongpliulpit-is-used-to-identify-allergies-and-it-applies-minuscule-allergen-amounts-aiding-in-mapping-your-allergenic-profile-it-is-mainly-used-to-diagnose-allergic-contact-dermatitispulli-dirltrpstrongdermoscopystrongpliulpa-non-invasive-procedure-employing-a-specialized-microscope-for-a-thorough-skin-examination-it-is-used-to-assess-blood-vessel-structures-pigmentation-patterns-or-any-other-features-that-are-not-visible-to-the-naked-eyenbsppulli-dirltrpstrongwoodrsquos-lamp-examinationstrongpliulpin-this-method-a-special-ultraviolet-light-woodrsquos-lamp-is-used-to-examine-the-skin-for-pigment-disorders-bacterial-or-fungal-infections-or-any-other-skin-related-conditions-that-fluoresce-under-uv-lightpulli-dirltrpstrongskin-prick-testingstrongpliulpskin-prick-testing-is-a-simple-diagnostic-technique-that-is-performed-to-assess-if-the-person-is-allergic-to-any-substance-like-pollen-or-not-in-this-test-the-skin-is-pricked-with-an-instrument-called-a-lancet-having-a-drop-of-allergen-solution-on-it-the-pricked-site-is-then-observed-for-any-signs-of-allergy-after-10-15-minutesnbspph2strongwhat-are-the-types-of-dermatologistsstrongh2psome-of-the-common-types-of-dermatologists-are-as-followsbrbrpulli-dirltrpstronggeneral-dermatologistsstrongpliulpgeneral-dermatologists-are-the-doctors-who-provide-comprehensive-care-for-a-variety-of-skin-conditions-such-as-eczema-acne-skin-cancer-screenings-psoriasis-athletersquos-foot-and-cosmetic-derma-proceduresnbsppulli-dirltrpstrongcosmetic-dermatologistsstrongpliulpcosmetic-dermatologists-focus-on-improving-the-appearance-of-the-skin-nails-and-hair-using-some-non-invasive-techniques-and-minimally-invasive-procedures-they-perform-treatments-including-dermal-fillers-botox-injections-laser-therapy-chemical-peels-and-cosmetic-surgerypulli-dirltrpstrongdermatopathologistsstrongpliulpdermatopathologists-are-doctors-who-specialize-in-diagnosing-skin-conditions-by-examining-skin-tissue-samples-under-a-microscope-they-play-an-important-role-in-confirming-diagnosis-and-also-guide-treatment-optionsnbsppulli-dirltrpstrongsurgical-dermatologistsstrongpliulpsurgical-dermatologists-are-the-doctors-who-are-experts-in-surgical-procedures-which-are-related-to-dermatological-issuesnbsppulli-dirltrpstrongpediatric-dermatologistsstrongpliulpthey-treat-congenital-genetic-and-acquired-dermatological-issues-that-affect-children-including-toddlers-and-newbornsnbsppulli-dirltrpstrongmohs-surgeonsstrongpliulpmohs-surgeons-are-surgeons-who-specialize-in-mohs-micrographic-surgery-it-is-a-precise-surgical-technique-that-is-used-to-remove-skin-cancer-and-preserve-healthy-tissues-as-much-as-possible-this-is-used-for-skin-cancers-on-the-facial-area-and-other-sensitive-areas-where-tissue-prevention-is-importantnbsppulli-dirltrpstrongmedical-dermatologistsstrongpliulpa-dermatologist-who-specializes-in-diagnosing-treating-and-preventing-diseases-related-to-skin-hair-and-nailsnbspph2stronghow-to-book-an-appointment-with-a-dermatologiststrongh2pyou-can-book-an-appointment-with-a-dermatologist-in-city-through-marham-by-following-these-stepspulli-dirltrpvisit-the-marham-website-or-download-the-marham-appplili-dirltrpsearch-for-quotstrongdermatologiststrongquot-and-specify-your-locationplili-dirltrpbrowse-through-the-list-of-strongdermatologistsnbspstrongavailable-in-your-cityplili-dirltrpselect-the-doctor-you-prefer-based-on-their-profile-reviews-and-fee-rangeplili-dirltrpchoose-a-convenient-date-and-time-for-your-appointmentplili-dirltrpconfirm-your-booking-and-make-any-necessary-payments-through-the-marham-platformplili-dirltrpyou-will-receive-a-confirmation-of-your-appointment-along-with-the-doctor39s-detailspliulh2strongwho-are-the-best-dermatologists-in-citystrongh2pthe-following-is-the-list-of-top-dermatologists-in-citypptopdoctorofspecialityph2strongwhy-choose-marhamstrongh2pthere-are-many-reasons-which-allow-marham-to-stand-apart-from-its-competitors-some-of-them-are-as-followspulli-dirltrpwe-have-approximately-strong48653-reviewsstrong-available-on-the-dermatologist-specialty-to-guide-you-throughout-the-appointment-processplilipyou-can-schedule-strongseamless-appointmentsstrong-with-verified-and-professional-healthcare-providersplili-dirltrpyou-donrsquot-have-to-wait-in-long-lines-you-can-book-strongvideo-consultationsstrong-with-top-doctors-in-pakistanplili-dirltrpwe-have-strongpmc-verified-doctorsstrong-to-provide-you-with-reliable-and-trusted-medical-adviceplili-dirltrpyou-can-ask-questions-from-our-verified-doctors-to-get-personalized-responsesnbspplili-dirltrpyou-can-enjoy-strongpromo-codes-and-special-offersstrong-on-various-doctors-hospitals-surgeries-services-and-labsplili-dirltrpto-ensure-affordable-healthcare-we-offer-strongdiscountsnbspstrongon-labs-online-and-physical-consultationsplili-dirltrpyou-can-book-an-appointment-for-professional-medical-assistance-with-available-doctorsplili-dirltrpour-strong157-customer-supportstrong-is-available-to-assist-and-guide-youplili-dirltrpwe-ensure-strongsecure-online-paymentsstrong-with-ssl-encryptionplili-dirltrpour-strong43-google-star-ratingstrong-speaks-of-our-best-in-class-servicespliulh2strongschedule-an-appointment-with-the-best-dermatologists-in-citystrongh2pmarham-features-a-list-ofstrongnbspdoctorscountstrong-highly-qualified-and-most-experienced-dermatologists-in-cityppbook-an-appointment-or-consult-online-with-a-dermatologist-in-city-by-calling-strong03111222398strong-you-can-choose-a-dermatologist-by-considering-the-doctorrsquos-patient-reviews-expertise-and-practice-location-for-personalized-and-reliable-careplisting-gender-area-titlebest-gender-dermatologist-in-area-city-skin-specialists-marhamlisting-area-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-arealisting-area-page-descriptionpfind-the-best-dermatologist-in-area-city-through-marham-there-are-doctorscount-dermatologists-serving-in-the-area-area-of-city-all-of-them-are-experts-in-dealing-with-various-skin-conditions-skin-specialist-in-area-city-treats-problems-like-randomthreediseases-etcph2strongwhat-are-the-diseases-treated-by-a-dermatologist-in-area-citystrongh2pa-dermatologist-is-a-doctor-who-is-specialized-in-treating-skin-hair-and-nail-conditions-dermatologists-in-area-city-are-well-trained-to-diagnose-treat-and-prevent-conditions-likepprandomtendiseaseslistppconsult-a-skin-specialist-immediately-in-area-city-if-you-have-any-of-these-or-other-skin-issues-that-require-medical-attention-these-skin-specialists-in-area-city-have-extensive-knowledge-and-experience-in-diagnosing-treating-and-managing-diseases-and-cosmetic-concerns-of-the-skinph2strongwhat-are-the-services-provided-by-a-dermatologist-in-area-citystrongh2psome-of-the-dermatological-and-cosmetic-services-provided-by-a-dermatologist-in-area-city-includepprandomtenserviceslistppstrongemread-to-know-more-aboutnbspemstronga-hrefhttpswwwmarhampkhealthblogwhat-does-a-dermatologist-do-relnoopener-noreferrer-target-blankstrongemwhat-a-dermatologist-doemstrongappnbspmarham-provides-its-patients-with-a-list-of-famous-dermatologists-in-area-city-you-can-consult-the-best-skin-specialist-in-area-city-listed-on-marham-for-all-the-a-hrefhttpswwwmarhampkhealthblogreasons-to-see-a-dermatologist-relnoopener-noreferrer-target-blankskin-issuesa-based-on-the-followingpulli-dirltrpstrongdoctorrsquos-feestrong-use-the-fee-range-filter-to-consult-the-most-affordable-dermatologist-according-to-your-choiceplili-dirltrpstrongpatient-reviewsstrong-select-the-dermatologist-in-area-city-based-on-the-patient-reviews-and-the-resulting-patient-satisfaction-scoreplili-dirltrpstrongservices-offeredstrong-select-the-doctor-who-provides-the-required-dermatological-services-according-to-your-requirementspliulpbook-an-appointment-with-the-top-dermatologists-who-are-best-for-skin-problems-in-area-city-nbspbased-on-their-qualifications-experience-and-patient-satisfaction-scorepptopdoctorofspecialityplisting-gender-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-arealisting-gender-page-descriptionpa-gender-dermatologist-is-a-medical-specialist-who-diagnoses-treats-and-prevents-various-conditions-of-skin-hair-and-nails-some-of-the-major-conditions-treated-by-a-gender-dermatologist-include-randomthreediseases-etcppmarham-enlists-almost-doctorscount-best-gender-dermatologists-in-cityph2strongwhat-are-the-diseases-treated-by-a-gender-dermatologist-in-citystrongh2pthe-gender-skin-specialists-in-city-provided-treatment-and-medication-for-all-the-major-conditions-affecting-the-skin-some-commonly-known-issues-that-gender-dermatologists-treat-are-as-followspprandomtendiseaseslistppyou-can-also-book-a-video-consultation-with-the-top-gender-skin-doctors-in-city-to-discuss-the-symptoms-of-skin-hair-or-nail-diseasesph2strongwhat-are-the-services-provided-by-a-gender-dermatologist-in-citystrongh2pgender-dermatologists-offer-the-following-servicespprandomtenserviceslistppadditionally-the-top-gender-skin-specialists-is-city-also-provides-services-such-asppstrongcancer-screeningnbspstrongthe-best-gender-dermatologists-perform-regular-skin-cancer-screenings-to-detect-any-abnormalities-at-earlier-stages-and-provide-necessary-treatmentppstrongeducation-and-preventionnbspstronggender-dermatologists-educate-patients-about-proper-skin-care-and-provide-advice-on-how-to-prevent-various-skin-conditions-they-also-recommend-skin-care-products-that-are-best-suitable-for-an-individualrsquos-skin-typeph2strongbook-an-appointment-with-the-gender-dermatologist-in-citystrongh2pmarham-offers-its-patients-a-range-of-well-known-gender-dermatologists-choose-a-gender-dermatologist-based-on-their-patient-satisfaction-score-qualification-and-fess-book-an-appointment-or-online-consultation-with-the-top-gender-dermatologists-nowplisting-gender-area-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-arealisting-gender-area-page-descriptionplooking-for-a-gender-dermatologist-in-area-city-look-no-further-marham-is-here-to-provide-the-list-of-best-gender-dermatologists-in-area-based-on-their-patientsrsquo-feedback-all-dermatologists-are-experts-in-dealing-with-numerous-health-conditions-dermatologists-in-area-city-are-experts-in-providing-solutions-to-diseases-like-randomthreediseasesppstrongnbspsome-common-problems-that-gender-dermatologists-in-area-city-treat-are-as-followsstrongpprandomtendiseaseslistppstronggender-dermatologists-offer-the-following-services-in-area-citystrongpprandomtenserviceslistppnbspmarham-provides-its-patients-with-a-list-of-famous-gender-dermatologists-in-area-city-choose-a-gender-dermatologist-according-to-their-patient-satisfaction-rate-and-book-an-appointment-or-consult-online-the-list-of-top-gender-dermatologists-based-on-patient-reviews-in-area-city-is-as-followspptopdoctorofspecialitypabout-us-contentbanner-infobanner-urlbanner-imagebanner-status0created-at2019-10-16t043229000000zupdated-at2024-05-16t071033000000zlogohttpsstaticmarhampkassetsimageskiosk70x70dermatologistjpg-islamabad

Dr. Fauzia Arshad

Available Today

Rs. 1000

70 Reviews

23+ Years Experience

dr-urooj-mirza-spid67specialitydermatologistspeciality-imagedermatologisttitledermatology-cosmetologytitle-2skinslugdermatologistdetailthe-specialists-who-treat-skin-problems-are-called-dermatologists-or-skin-specialistscausesspecialitysoundextrmtljsturdu-nameu0645u0627u06c1u0631-u0627u0645u0631u0627u0636-u062cu0644u062fparent3parent-slugdermatologist-cosmetologistseo-h1doctorscount-best-gender-dermatologist-skin-specialist-in-area-cityseo-h2dermatologist-skin-specialist-city-descriptionseo-titlebest-gender-certified-dermatologist-verified-skin-doctors-in-area-city-marhamseo-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-areaseo-page-descriptionp-styletext-align-justifyabove-is-the-list-of-strongpmc-pakistan-medical-commission-verified-gender-dermatologists-in-citystrong-you-can-view-their-experience-practice-locations-timings-services-fees-and-patient-reviews-you-can-also-find-the-best-dermatologists-in-city-on-the-basis-of-area-fee-gender-and-availability-more-than-doctorscount-top-dermatologists-of-city-are-listed-here-strongbook-an-appointmentstrong-or-strongconsult-onlinestrongph3-styletext-align-justifywho-is-a-dermatologisth3p-styletext-align-justifygender-dermatologists-are-doctors-who-treat-and-diagnose-the-istrongssues-that-affect-our-hair-skinstrong-and-nails-moreover-strongdermatologists-also-deal-with-mucous-membranes-the-tissue-that-lines-your-nose-mouth-and-also-eyelidsstrongph3-styletext-align-justifygender-dermatologists-diagnose-and-treat-the-following-skin-issuesh3ulli-styletext-align-justifystrongacnestronglili-styletext-align-justifyskin-rasheslili-styletext-align-justifydull-complexionlili-styletext-align-justifydiscolorationlili-styletext-align-justifypigmentationlili-styletext-align-justifyvarious-allergies-and-blood-disorders-with-diabeteslili-styletext-align-justifystronghair-fallstronglili-styletext-align-justifystrongdandruffstrongliulp-styletext-align-justifyapart-from-these-issues-stronggender-dermatologistsstrong-also-recognize-and-diagnose-symptoms-of-various-underlying-health-issues-ie-diabetes-has-an-impact-on-the-strongskin-appearancestrong-and-a-dermatologist-might-be-the-first-one-to-diagnose-itpp-styletext-align-justifystrongtheir-work-splits-into-these-three-branchesstrongpulli-styletext-align-justifystrongmedicalstrong-gender-dermatologists-work-on-the-diagnosis-and-treatments-of-the-conditions-that-affect-our-skinlili-styletext-align-justifystrongsurgerystrong-they-also-do-minor-surgeries-to-remove-moles-or-wartslili-styletext-align-justifystrongcosmeticstrong-they-also-deal-with-all-those-issues-that-affect-our-appearances-ie-hair-loss-dark-spots-and-wrinklesliulh3-styletext-align-justifywhen-to-see-a-dermatologisth3p-styletext-align-justifydermatologists-deal-with-various-issues-that-affect-the-skin-hair-or-nails-you-should-visit-a-stronggender-dermatologist-every-six-to-eight-monthsstrong-in-case-you-experience-the-following-symptoms-you-should-see-a-gender-dermatologist-immediatelypulli-styletext-align-justifyskin-rasheslili-styletext-align-justifyskin-irritationburninglili-styletext-align-justifyitchy-and-flaky-skinlili-styletext-align-justifyacnelili-styletext-align-justifystrongskin-blemishesstronglili-styletext-align-justifystrongskin-discolorationstronglili-styletext-align-justifystrongmoles-warts-and-other-growth-on-the-skinstronglili-styletext-align-justifystrongvaricose-veinsstronglili-styletext-align-justifystrongwrinkles-sun-damage-and-sagging-skinstronglili-styletext-align-justifystronghair-damagestronglili-styletext-align-justifyhair-falllili-styletext-align-justifydandrufflili-styletext-align-justifyfingernail-or-toenail-issuesliulh3-styletext-align-justifywhat-issues-are-treated-by-dermatologists-in-cityh3p-styletext-align-justifygender-dermatologists-treat-all-the-health-issues-that-relate-to-our-skin-hair-and-nails-moreover-they-provide-a-wide-range-of-services-and-also-treat-the-following-issuespulli-styletext-align-justifybiopsies-they-do-different-types-of-biopsies-to-diagnose-or-cross-check-the-symptoms-of-skin-cancers-and-other-conditionslili-styletext-align-justifystronglaser-therapystrong-they-use-laser-treatments-to-remove-warts-moles-sun-spots-tattoos-acne-scars-blemishes-wrinkles-and-unwanted-hairlili-styletext-align-justifysurgical-procedures-they-do-surgical-procedures-to-remove-moles-tags-on-the-skin-and-lesionslili-styletext-align-justifysclerotherapy-they-perform-this-procedure-to-treat-spider-and-varicose-veinslili-styletext-align-justifystrongmohs-surgerystrong-this-treatment-removes-a-thin-tissue-layer-around-a-tumorlili-styletext-align-justifychemical-peels-this-procedure-works-wonders-on-our-face-to-remove-the-dead-and-damaged-skinlili-styletext-align-justifystrongcosmetic-injectionsstrong-these-injections-help-diminish-the-wrinkly-and-sagging-skinlili-styletext-align-justifydermabrasion-dermatologists-use-this-technique-to-reduce-the-appearance-of-fine-lines-strongage-spotsstrong-and-strongacne-scarsstronglili-styletext-align-justifytumescent-liposuction-dermatologists-use-liposuction-treatment-for-the-removal-of-unwanted-fat-from-targeted-areas-of-our-bodyliulp-styletext-align-justifyyou-should-strongbook-an-appointment-or-online-consultation-with-the-best-gender-dermatologists-in-citystrong-if-you-face-any-of-the-issues-mentioned-aboveph3-styletext-align-justifywhat-types-of-dermatologists-are-thereh3p-styletext-align-justifyfollowing-are-the-four-main-types-of-gender-dermatologistspulli-styletext-align-justifydermatopathologists-the-ones-who-work-on-the-root-causes-of-the-origin-of-strongvarious-skin-diseasesstronglili-styletext-align-justifystrongpediatric-dermatologistsstrong-these-dermatologists-work-specifically-with-strongskin-issues-in-childrennbspstrongunder-12-years-of-agelili-styletext-align-justifyimmunodermatologists-such-dermatologists-focus-on-examining-how-the-immune-system-interacts-with-our-skin-and-skin-manifestation-of-various-autoimmune-diseaseslili-styletext-align-justifystrongcosmetic-dermatologistsstrong-unlike-immunodermatologists-these-strongtypes-of-dermatologistsstrong-are-the-most-common-ones-that-we-can-find-in-the-field-of-dermatologyliulh3-styletext-align-justifywhat-is-the-qualification-of-a-dermatologisth3p-styletext-align-justifyin-pakistan-stronggender-dermatologistsstrong-are-mbbs-doctors-who-complete-their-five-years-of-study-in-a-medical-college-after-this-gender-dermatologists-become-fellow-of-the-college-of-physicians-and-surgeons-pakistan-fcps-in-their-respective-specialty-all-the-gender-dermatologists-are-pmc-pakistan-medical-commission-verified-however-many-stronggender-dermatologistsstrong-go-on-to-further-specialize-from-abroad-such-as-caaam-d-dermatology-and-othersph3-styletext-align-justifywhat-things-you-should-keep-in-mind-while-selecting-a-dermatologisth3p-styletext-align-justifybefore-choosing-a-gender-dermatologist-you-need-to-think-very-carefully-and-evaluate-your-options-on-the-following-basispulli-styletext-align-justifyexperience-of-the-gender-dermatologistlili-styletext-align-justifyservices-of-the-gender-dermatologist-that-whether-the-gender-dermatologist-provides-the-service-you-are-looking-for-or-notlili-styletext-align-justifyqualifications-of-the-gender-dermatologist-you-should-see-how-qualified-the-gender-dermatologist-islili-styletext-align-justifystrongreviews-of-the-patientsstrong-you-should-read-the-patientrsquos-feedback-this-will-help-you-in-making-an-informed-decision-for-gender-dermatologists-to-seeliulh3-styletext-align-justifywho-are-the-best-gender-dermatologists-in-cityh3p-styletext-align-justifyon-the-basis-of-experience-reviews-and-patients39-feedback-we-have-shortlisted-the-strongtop-five-gender-dermatologists-in-citystrong-their-names-are-as-followspptopdoctorofspecialityph3-styletext-align-justifybook-appointment-or-consult-online-through-marhampkh3p-styletext-align-justifyyou-can-strongbook-an-appointment-or-online-video-consultationstrong-with-the-strongbest-dermatologists-in-city-through-marhampkstrong-pakistanrsquos-no1-healthcare-platform-you-can-book-your-appointment-online-or-call-our-helpline-03111222398-marham-has-so-far-helped-10-million-patients-to-book-their-appointments-with-verified-doctors-we-are-the-largest-service-providing-startup-in-pakistan-stronggoogle-and-facebook-have-awarded-marham-in-recognition-of-its-servicesstrongpp-styletext-align-justifywe-have-registered-the-strongbest-gender-dermatologists-in-citystrong-on-our-platform-now-you-can-avail-the-strongbest-healthcarestrong-with-ease-and-comfort-patients-reviews-practice-details-experience-timing-slots-are-available-to-make-it-easier-for-you-to-strongbook-an-appointmentstrong-you-can-also-consult-online-with-the-strongbest-gender-dermatologists-in-citystrong-and-discuss-your-issues-via-audiostrongvideo-callstrongpp-styletext-align-justifycontent-reviewed-by-a-hrefhttpswwwmarhampkdoctorslahoredermatologistdr-saleha-zeeshandr-saleha-zeeshan-dermatologistapseo-keywordsskin-specialist-skin-doctor-cosmetic-surgeon-aesthetic-physician-cosmetologist-u0645u0627u06c1u0631-u0627u0645u0631u0627u0636-u062cu0644u062fonline-consultation-videohttpswwwyoutubecomwatchv8vapchlro8wposition2redirect-tonullfaqsquestionwhat-is-the-fee-of-a-dermatologist-in-cityanswerpthe-fee-for-a-dermatologist-in-city-generally-ranges-between-rs-strongfeerangestrongpquestionwho-are-the-top-reviewed-dermatologists-in-cityanswerpthe-following-are-the-top-reviewed-dermatologists-in-citypptoprevieweddoctorspquestionwho-are-the-most-experienced-dermatologists-in-cityanswerpthe-following-are-the-most-experienced-dermatologists-in-cityppmostexperienceddoctorspquestionhow-to-book-an-appointment-with-a-dermatologist-in-cityanswerpyou-can-book-an-appointment-with-a-dermatologist-by-visiting-the-doctorrsquos-profile-or-by-calling-our-marham-helpline-at-strong03111222398strongpquestiondo-i-have-to-pay-extra-charges-if-i-book-a-dermatologist-consultation-via-marhampkanswerpno-you-donrsquot-have-to-pay-any-extra-charges-if-you-book-a-dermatologist-consultation-via-marhampkpquestionwhat-are-the-payment-methods-for-online-consultationanswerpyou-can-use-any-of-the-following-payment-methodspullibank-transferlilicredit-cardlilieasy-paisa-or-jazz-cashliulquestiondo-you-have-a-dermatologist-under-1000-in-cityanswerpmarham-has-affordable-dermatologists-whom-you-can-consult-for-under-rs-1000-here39s-the-listpplessthanthousanddoctorspactionsis-pmdc-mandatory-1-is-doctor-prefix-required-1algo-status0algo-updated-at2022-08-17t094603000000zalgo-updated-by639669seo-contentlisting-h1doctorscount-best-dermatologist-in-city-top-skin-specialistslisting-h2what-is-dermatologylisting-titledoctorscount-best-dermatologist-in-city-top-skin-specialist-marhamlisting-area-h1doctorscount-best-gender-dermatologist-in-area-city-top-skin-specialistlisting-area-h2best-dermatologist-in-area-citylisting-gender-h1doctorscount-best-gender-dermatologistskin-specialist-in-area-citylisting-gender-h2gender-dermatologist-in-city-introductionlisting-area-titledoctorscount-best-gender-dermatologist-in-area-city-top-skin-specialist-marhamlisting-gender-titlebest-gender-dermatologist-in-area-city-top-skin-specialist-marhamlisting-gender-area-h1doctorscount-best-gender-dermatologist-skin-specialist-in-area-citylisting-gender-area-h2gender-dermatologist-in-area-city-introductionlisting-meta-descriptionmarham-can-help-you-find-a-dermatologist-in-city-for-your-skin-care-book-an-appointment-with-the-top-skin-specialist-near-you-based-on-their-experience-and-patient-reviewslisting-page-descriptionpa-dermatologist-is-a-medical-doctor-who-specializes-in-medicine-and-further-specializes-in-diagnosing-and-treating-hair-skin-nails-and-mucus-membrane-diseases-some-dermatologists-specializing-in-derma-surgery-are-known-as-dermatologist-surgeonsnbspppthey-are-highly-trained-physicians-who-are-extensively-trained-in-accurately-diagnosing-and-properly-treating-skin-hair-and-nail-related-diseases-they-can-also-manage-cosmetic-disorders-such-as-scars-hair-loss-etcnbspppdermatologists-treat-more-than-3000-skin-hair-and-nail-diseases-as-well-as-cosmetic-concernsnbspph2strongwhat-is-dermatologystrongh2pdermatology-is-the-branch-of-medicine-that-involves-researching-studying-diagnosing-managing-and-treating-conditions-that-affect-the-skin-nails-hair-and-mucus-membranesppit-is-a-specialty-having-both-medical-and-surgical-aspects-the-people-who-study-and-specialize-in-dermatology-and-skin-related-diseases-are-known-as-dermatologistsnbspph2strongalternative-names-for-a-dermatologist-in-citystrongh2psome-of-the-alternative-names-of-a-dermatologist-in-city-are-as-followspulli-dirltrpskin-specialistplili-dirltrpskin-doctorplili-dirltrpcosmetologistplili-dirltrpaesthetic-physicianpliulh2strongwhen-to-see-a-dermatologiststrongh2pyou-should-see-a-dermatologist-to-treat-all-if-you-notice-any-of-the-following-symptoms-or-issuespulli-dirltrpif-you-have-dry-itchy-skin-or-scalpplili-dirltrpif-you-have-any-kind-of-skin-allergiesplili-dirltrpif-you-have-skin-growths-such-as-warts-moles-or-cystsplili-dirltrpif-you-are-facing-hair-damage-or-hair-lossplili-dirltrpif-you-have-any-irregular-skin-growthsplili-dirltrpif-you-have-skin-discolorationplili-dirltrpif-you-have-lesions-or-asymmetrical-molesplili-dirltrpif-you-are-experiencing-frequent-acneplili-dirltrpif-you-are-having-excessive-dandruffplili-dirltrpif-you-are-dealing-with-stubborn-acne-or-acne-marksplili-dirltrpif-you-have-anything-like-nail-abnormalitiesplili-dirltrpif-you-have-unusual-bumps-or-lumps-on-any-part-of-the-skinplili-dirltrpif-you-have-burns-scars-or-acne-marksnbsppliulpif-you-are-facing-any-of-these-conditions-or-any-other-skin-related-issues-then-consult-the-best-dermatologist-in-pakistan-rather-than-ignoring-these-or-doing-any-diysnbspppmoreover-you-can-also-consult-a-dermatologist-if-you-want-any-cosmetic-treatments-to-improve-the-look-tone-and-texture-of-your-skinnbspph2strongwhat-are-the-main-areas-of-concern-for-a-dermatologiststrongh2psome-of-the-main-areas-of-concern-for-a-dermatologist-are-as-followspullidiagnosing-the-skin-hair-or-nails-related-conditionslilitreating-and-managing-those-areas-of-concern-like-eczema-acne-acne-scarsliliprescribing-medicines-ointments-creams-etc-to-overcome-the-derma-issuelilimaking-cosmetic-improvements-to-the-patientrsquos-issue-via-various-procedures-including-chemical-peels-dermabrasion-etcliulh2strongwhat-services-do-dermatologists-providestrongh2phere-are-some-of-the-services-that-a-skin-specialist-can-providepulli-dirltrpstrongdiagnosis-and-treatmentstrongpliulpprofessional-dermatologists-diagnose-and-treat-any-of-the-hair-skin-nails-and-mucus-membrane-diseases-they-perform-thorough-screening-tests-and-diagnosis-to-determine-the-perfect-treatment-for-the-problempulli-dirltrpstrongcosmetic-proceduresstrongpliulpdermatologists-also-perform-various-cosmetic-procedures-including-dermal-fillers-botox-injections-chemical-peels-etcnbsppulli-dirltrpstrongsurgical-proceduresstrongpliulpthey-also-perform-surgical-procedures-to-treat-any-severe-condition-that-cannot-be-treated-with-any-normal-cosmetic-procedures-surgical-procedures-include-skin-biopsy-mole-removal-cyst-removal-etcnbsppulli-dirltrpstrongmanagement-of-chronic-conditionsstrongpliulpdermatologists-also-manage-several-chronic-conditions-including-vitiligo-and-rosaceanbsppulli-dirltrpstronggive-advicestrongpliulpdermatologists-also-provide-advice-on-skincare-routines-products-and-other-diy-things-for-various-skin-conditions-and-typesph2strongwhat-conditions-does-a-dermatologist-treatstrongh2pdermatologists-can-diagnose-and-treat-hundreds-of-conditions-related-to-hair-skin-nails-and-mucus-membranes-includingpulli-dirltrpa-hrefhttpswwwmarhampkall-diseaseseczemastrongeczemastrongastrongnbspstrongpliulpa-nbspdisease-condition-that-makes-your-skin-red-and-itchy-and-is-treated-by-your-dermatologist-using-ointments-and-creamspulli-dirltrpa-hrefhttpswwwmarhampkall-diseasespimplesstrongpimplenbspstrongapliulpthey-are-small-pustules-that-are-raised-on-the-skin-due-to-excessive-sebum-production-and-dust-which-are-routinely-managed-by-a-dermatologist-based-on-the-severity-of-the-skin-conditionpulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesdandruffstrongdandruffstrongapliulpmany-people-around-the-world-face-dandruff-issues-it-causes-the-skin-on-the-scalp-to-flake-it-is-not-a-serious-or-contagious-condition-however-it-is-difficult-to-treat-and-can-be-embarrassingpulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesmelasmastrongmelasmastrongapliulpmelasma-is-a-skin-problem-that-is-caused-by-brown-to-gray-brown-patches-on-the-skin-of-the-face-mostly-it-affects-the-chin-cheeks-nose-bridge-forehead-above-the-upper-lip-etc-it-is-more-common-in-women-as-compared-to-men-the-most-common-cause-of-melasma-is-pregnancynbsppullia-hrefhttpswwwmarhampkall-diseasesskin-cancerstrongskin-cancerstrongaliulpskin-cancer-is-the-uncontrolled-division-of-abnormal-cells-in-the-outermost-layer-of-the-skin-it-is-caused-by-unrepaired-dna-damage-that-triggers-mutation-surgical-dermatologist-treats-skin-cancer-via-surgical-interventions-radiation-therapy-immunotherapy-chemotherapy-etcnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesacnepakistanstrongacnestrongastrongnbspstrongpliulpacne-resulting-from-clogged-hair-follicles-by-oil-dirt-or-dead-cells-is-evaluated-by-a-dermatologist-who-then-prescribes-suitable-topical-remediespulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesingrown-nailsstrongingrown-nailsstrongapliulpingrown-nails-is-the-toe-condition-when-the-corner-of-the-toenail-grows-down-into-the-skin-dermatologists-can-treat-all-nails-related-issues-including-fungal-nails-clubbing-changes-in-the-thickness-of-nails-nail-discoloration-etcpulli-dirltrpa-hrefhttpswwwmarhampkall-serviceshair-restorationlahorestronghair-lossstrongastrongnbspstrongpliulpit-is-a-common-issue-in-young-people-nowadays-and-also-in-older-adults-a-dermatologist-provides-treatment-for-hair-loss-using-injections-medicines-and-laser-therapypulli-dirltrpa-hrefhttpswwwmarhampkall-diseaseswartsstrongwartstrongastrongnbspstrongpliulpyour-skin-doctor-provides-peeling-medicines-or-removes-the-skin-outgrowths-and-moles-through-surgical-excision-they-also-help-to-prevent-fungal-infections-causing-such-conditionspulli-dirltrpa-hrefhttpswwwmarhampkall-diseasespsoriasisstrongpsoriasisstrongastrongstrongpliulppsoriasis-is-an-autoimmune-disease-that-causes-itchy-red-patches-on-the-skin-as-this-disease-is-an-autoimmune-disease-therefore-it-is-chronic-however-dermatologists-can-prescribe-medicines-injections-and-therapies-to-manage-the-symptomsnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-servicesremoval-of-moles-wartsstrongmolesstrongapliulpmoles-are-brown-or-black-growths-on-the-skin-that-are-normally-harmless-and-form-in-childhood-and-adolescence-a-dermatologist-can-remove-moles-by-implementing-surgical-procedures-or-other-treatment-optionsnbsppulli-dirltrpstrongdermatitisnbspstrongpliulpa-dermatologist-treats-red-itchy-rash-and-inflamed-skin-by-prescribing-skin-creams-and-moisturizerspulli-dirltrpstrongathletersquos-foot-tinea-pedisstrongpliulpathletersquos-foot-is-a-fungal-skin-condition-that-begins-between-the-toes-it-is-an-infection-that-causes-white-patches-between-the-toes-skin-specialists-recommend-ointments-tablets-and-creams-to-treat-this-conditionnbspph2strongwhat-are-common-procedures-performed-by-a-dermatologiststrongh2ulli-dirltrpa-hrefhttpswwwmarhampkall-servicesskin-whiteningstrongskin-whiteningstrongapliulpthis-procedure-can-help-to-lighten-dark-spots-and-blemishes-on-the-skin-it-functions-by-reducing-the-production-and-concentration-of-melanin-in-the-skin-it-is-also-used-to-lighten-the-overall-skin-tone-of-a-personnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-servicesrf-for-skin-tighteningstrongskin-tighteningstrongapliulpskin-tightening-can-help-to-reduce-the-appearance-of-wrinkles-and-sagging-skin-it-is-also-used-to-do-face-slimming-and-to-improve-the-skin-elasticitynbsppulli-dirltrpa-hrefhttpswwwmarhampkall-diseasespsoriasisstrongpsoriasis-treatmentstrongapliulpthis-condition-causes-red-scaly-patches-on-the-skin-a-dermatologist-can-prescribe-medications-or-recommend-other-treatments-to-help-manage-psoriasis-certain-ointments-topical-corticosteroids-and-steroid-creams-are-commonly-prescribed-to-treat-mild-to-moderate-psoriasis-this-treatment-functions-by-reducing-inflammation-by-slowing-the-production-of-skin-cells-and-lessening-itchingpulli-dirltrpa-hrefhttpswwwmarhampkspecial-offerslaser-hair-removal-68stronglaser-hair-removalstrongapliulpthis-procedure-can-inhibit-or-delay-the-growth-of-the-unwanted-hair-in-this-procedure-the-laser-is-applied-to-the-area-from-where-you-want-to-remove-any-unwanted-hairnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesrosaceapakistanstrongrosacea-treatmentstrongapliulpthis-condition-causes-redness-flushing-and-pimples-on-the-face-a-dermatologist-can-prescribe-medications-or-recommend-other-treatments-to-help-manage-rosaceapulli-dirltrpa-hrefhttpswwwmarhampkall-servicesdermal-fillerstrongdermal-fillersstrongapliulpdermal-fillers-are-commonly-used-by-cosmetic-facial-surgeons-to-lessen-the-signs-of-aging-minimize-skin-scars-and-depressions-and-treat-fine-lines-and-deep-wrinkles-these-injections-can-fill-in-wrinkles-and-other-facial-folds-they-can-also-be-used-to-fill-in-the-hollow-areas-under-the-eyespulli-dirltrpa-hrefhttpswwwmarhampkall-serviceshair-transplantstronghair-transplantationstrongapliulpthis-procedure-can-be-used-to-restore-hair-loss-for-hair-transplantation-there-are-various-techniques-but-all-hair-transplantations-involve-taking-hair-from-one-part-of-the-scalp-and-grafting-those-hair-onto-bald-or-thin-areas-of-the-scalpppsome-of-the-strongother-proceduresnbspstrongcommonly-performed-by-a-dermatologist-are-as-followspulli-dirltrpchemical-peelsplili-dirltrphydrafacialplili-dirltrpmedicated-facialsplili-dirltrpmicroneedlingplili-dirltrpcryosurgeryplili-dirltrpmohs-surgeryplili-dirltrpmicrodermabrasionpliulh2strongwhat-are-the-most-common-skin-diseases-in-pakistanstrongh2pdermatologists-can-treat-over-em3000nbspemskin-nails-and-hair-related-diseases-the-most-common-ones-are-as-followspulliacne-vulgarisliliscabiesliliimpetigolilieczema-atopic-dermatitisliliseborrheic-dermatitislilifolliculitisliliurticarianbsplilifungal-infections-ringwormlilipsoriasislilivitiligolilimelasmaliliskin-cancerlilitinea-pedis-athletersquos-footliulh2stronghow-to-prepare-for-a-visit-to-a-dermatologiststrongh2pbefore-visiting-a-dermatologist-one-should-keep-the-following-things-in-mindpulli-dirltrpmake-a-list-of-your-issues-and-concerns-or-any-symptoms-that-you-have-noticedplili-dirltrpif-you-have-any-medical-history-then-make-sure-to-keep-the-documents-prescriptions-etcplili-dirltrplist-down-all-the-supplements-medications-or-any-topical-products-that-you-are-usingplili-dirltrpmake-sure-that-your-skin-is-clean-and-free-of-makeupplili-dirltrpdescribe-your-skincare-routine-including-products-and-frequency-of-useplili-dirltrpavoid-wearing-nail-polish-before-visiting-a-dermatologistplili-dirltrpshare-your-family-medical-history-otc-products-etc-with-the-doctorplili-dirltrpwear-comfortable-clothes-so-that-it-is-easy-for-the-doctor-to-access-and-examine-the-affected-skin-areasplili-dirltrpprepare-a-list-of-questions-or-concerns-that-you-want-to-discuss-with-the-dermatologistplili-dirltrptake-pictures-of-the-areas-that-you-cannot-show-to-the-doctor-before-the-visitpliulh2strongwhat-are-some-diagnostic-techniques-used-by-dermatologistsstrongh2pnormally-dermatologists-perform-a-physical-examination-of-the-affected-area-to-diagnose-any-condition-the-doctor-may-prescribe-some-additional-tests-biopsies-skin-cultures-patch-tests-etc-to-accurately-diagnose-the-diseasenbspppsome-of-the-common-diagnostic-methods-performed-and-recommended-by-a-dermatologist-are-as-followspulli-dirltrpstrongvisual-examinationstrongpliulpone-of-the-basic-and-common-ways-of-diagnosing-a-condition-is-the-visual-physical-examination-of-the-affected-area-the-doctor-may-look-for-any-rashes-lesions-lumps-scars-etcnbsppulli-dirltrpstrongskin-culturestrongpliulpthis-test-is-used-to-identify-the-bacteria-or-fungus-that-is-causing-an-infectionpulli-dirltrpstrongskin-biopsystrongpliulpthis-technique-enables-an-in-depth-cellular-level-diagnosis-in-this-procedure-a-small-sample-of-the-skin-tissue-is-removed-and-examined-under-a-microscope-to-diagnose-various-skin-conditions-including-inflammatory-disorders-skin-cancer-and-infectionspulli-dirltrpstrongpatch-teststrongpliulpit-is-used-to-identify-allergies-and-it-applies-minuscule-allergen-amounts-aiding-in-mapping-your-allergenic-profile-it-is-mainly-used-to-diagnose-allergic-contact-dermatitispulli-dirltrpstrongdermoscopystrongpliulpa-non-invasive-procedure-employing-a-specialized-microscope-for-a-thorough-skin-examination-it-is-used-to-assess-blood-vessel-structures-pigmentation-patterns-or-any-other-features-that-are-not-visible-to-the-naked-eyenbsppulli-dirltrpstrongwoodrsquos-lamp-examinationstrongpliulpin-this-method-a-special-ultraviolet-light-woodrsquos-lamp-is-used-to-examine-the-skin-for-pigment-disorders-bacterial-or-fungal-infections-or-any-other-skin-related-conditions-that-fluoresce-under-uv-lightpulli-dirltrpstrongskin-prick-testingstrongpliulpskin-prick-testing-is-a-simple-diagnostic-technique-that-is-performed-to-assess-if-the-person-is-allergic-to-any-substance-like-pollen-or-not-in-this-test-the-skin-is-pricked-with-an-instrument-called-a-lancet-having-a-drop-of-allergen-solution-on-it-the-pricked-site-is-then-observed-for-any-signs-of-allergy-after-10-15-minutesnbspph2strongwhat-are-the-types-of-dermatologistsstrongh2psome-of-the-common-types-of-dermatologists-are-as-followsbrbrpulli-dirltrpstronggeneral-dermatologistsstrongpliulpgeneral-dermatologists-are-the-doctors-who-provide-comprehensive-care-for-a-variety-of-skin-conditions-such-as-eczema-acne-skin-cancer-screenings-psoriasis-athletersquos-foot-and-cosmetic-derma-proceduresnbsppulli-dirltrpstrongcosmetic-dermatologistsstrongpliulpcosmetic-dermatologists-focus-on-improving-the-appearance-of-the-skin-nails-and-hair-using-some-non-invasive-techniques-and-minimally-invasive-procedures-they-perform-treatments-including-dermal-fillers-botox-injections-laser-therapy-chemical-peels-and-cosmetic-surgerypulli-dirltrpstrongdermatopathologistsstrongpliulpdermatopathologists-are-doctors-who-specialize-in-diagnosing-skin-conditions-by-examining-skin-tissue-samples-under-a-microscope-they-play-an-important-role-in-confirming-diagnosis-and-also-guide-treatment-optionsnbsppulli-dirltrpstrongsurgical-dermatologistsstrongpliulpsurgical-dermatologists-are-the-doctors-who-are-experts-in-surgical-procedures-which-are-related-to-dermatological-issuesnbsppulli-dirltrpstrongpediatric-dermatologistsstrongpliulpthey-treat-congenital-genetic-and-acquired-dermatological-issues-that-affect-children-including-toddlers-and-newbornsnbsppulli-dirltrpstrongmohs-surgeonsstrongpliulpmohs-surgeons-are-surgeons-who-specialize-in-mohs-micrographic-surgery-it-is-a-precise-surgical-technique-that-is-used-to-remove-skin-cancer-and-preserve-healthy-tissues-as-much-as-possible-this-is-used-for-skin-cancers-on-the-facial-area-and-other-sensitive-areas-where-tissue-prevention-is-importantnbsppulli-dirltrpstrongmedical-dermatologistsstrongpliulpa-dermatologist-who-specializes-in-diagnosing-treating-and-preventing-diseases-related-to-skin-hair-and-nailsnbspph2stronghow-to-book-an-appointment-with-a-dermatologiststrongh2pyou-can-book-an-appointment-with-a-dermatologist-in-city-through-marham-by-following-these-stepspulli-dirltrpvisit-the-marham-website-or-download-the-marham-appplili-dirltrpsearch-for-quotstrongdermatologiststrongquot-and-specify-your-locationplili-dirltrpbrowse-through-the-list-of-strongdermatologistsnbspstrongavailable-in-your-cityplili-dirltrpselect-the-doctor-you-prefer-based-on-their-profile-reviews-and-fee-rangeplili-dirltrpchoose-a-convenient-date-and-time-for-your-appointmentplili-dirltrpconfirm-your-booking-and-make-any-necessary-payments-through-the-marham-platformplili-dirltrpyou-will-receive-a-confirmation-of-your-appointment-along-with-the-doctor39s-detailspliulh2strongwho-are-the-best-dermatologists-in-citystrongh2pthe-following-is-the-list-of-top-dermatologists-in-citypptopdoctorofspecialityph2strongwhy-choose-marhamstrongh2pthere-are-many-reasons-which-allow-marham-to-stand-apart-from-its-competitors-some-of-them-are-as-followspulli-dirltrpwe-have-approximately-strong48653-reviewsstrong-available-on-the-dermatologist-specialty-to-guide-you-throughout-the-appointment-processplilipyou-can-schedule-strongseamless-appointmentsstrong-with-verified-and-professional-healthcare-providersplili-dirltrpyou-donrsquot-have-to-wait-in-long-lines-you-can-book-strongvideo-consultationsstrong-with-top-doctors-in-pakistanplili-dirltrpwe-have-strongpmc-verified-doctorsstrong-to-provide-you-with-reliable-and-trusted-medical-adviceplili-dirltrpyou-can-ask-questions-from-our-verified-doctors-to-get-personalized-responsesnbspplili-dirltrpyou-can-enjoy-strongpromo-codes-and-special-offersstrong-on-various-doctors-hospitals-surgeries-services-and-labsplili-dirltrpto-ensure-affordable-healthcare-we-offer-strongdiscountsnbspstrongon-labs-online-and-physical-consultationsplili-dirltrpyou-can-book-an-appointment-for-professional-medical-assistance-with-available-doctorsplili-dirltrpour-strong157-customer-supportstrong-is-available-to-assist-and-guide-youplili-dirltrpwe-ensure-strongsecure-online-paymentsstrong-with-ssl-encryptionplili-dirltrpour-strong43-google-star-ratingstrong-speaks-of-our-best-in-class-servicespliulh2strongschedule-an-appointment-with-the-best-dermatologists-in-citystrongh2pmarham-features-a-list-ofstrongnbspdoctorscountstrong-highly-qualified-and-most-experienced-dermatologists-in-cityppbook-an-appointment-or-consult-online-with-a-dermatologist-in-city-by-calling-strong03111222398strong-you-can-choose-a-dermatologist-by-considering-the-doctorrsquos-patient-reviews-expertise-and-practice-location-for-personalized-and-reliable-careplisting-gender-area-titlebest-gender-dermatologist-in-area-city-skin-specialists-marhamlisting-area-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-arealisting-area-page-descriptionpfind-the-best-dermatologist-in-area-city-through-marham-there-are-doctorscount-dermatologists-serving-in-the-area-area-of-city-all-of-them-are-experts-in-dealing-with-various-skin-conditions-skin-specialist-in-area-city-treats-problems-like-randomthreediseases-etcph2strongwhat-are-the-diseases-treated-by-a-dermatologist-in-area-citystrongh2pa-dermatologist-is-a-doctor-who-is-specialized-in-treating-skin-hair-and-nail-conditions-dermatologists-in-area-city-are-well-trained-to-diagnose-treat-and-prevent-conditions-likepprandomtendiseaseslistppconsult-a-skin-specialist-immediately-in-area-city-if-you-have-any-of-these-or-other-skin-issues-that-require-medical-attention-these-skin-specialists-in-area-city-have-extensive-knowledge-and-experience-in-diagnosing-treating-and-managing-diseases-and-cosmetic-concerns-of-the-skinph2strongwhat-are-the-services-provided-by-a-dermatologist-in-area-citystrongh2psome-of-the-dermatological-and-cosmetic-services-provided-by-a-dermatologist-in-area-city-includepprandomtenserviceslistppstrongemread-to-know-more-aboutnbspemstronga-hrefhttpswwwmarhampkhealthblogwhat-does-a-dermatologist-do-relnoopener-noreferrer-target-blankstrongemwhat-a-dermatologist-doemstrongappnbspmarham-provides-its-patients-with-a-list-of-famous-dermatologists-in-area-city-you-can-consult-the-best-skin-specialist-in-area-city-listed-on-marham-for-all-the-a-hrefhttpswwwmarhampkhealthblogreasons-to-see-a-dermatologist-relnoopener-noreferrer-target-blankskin-issuesa-based-on-the-followingpulli-dirltrpstrongdoctorrsquos-feestrong-use-the-fee-range-filter-to-consult-the-most-affordable-dermatologist-according-to-your-choiceplili-dirltrpstrongpatient-reviewsstrong-select-the-dermatologist-in-area-city-based-on-the-patient-reviews-and-the-resulting-patient-satisfaction-scoreplili-dirltrpstrongservices-offeredstrong-select-the-doctor-who-provides-the-required-dermatological-services-according-to-your-requirementspliulpbook-an-appointment-with-the-top-dermatologists-who-are-best-for-skin-problems-in-area-city-nbspbased-on-their-qualifications-experience-and-patient-satisfaction-scorepptopdoctorofspecialityplisting-gender-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-arealisting-gender-page-descriptionpa-gender-dermatologist-is-a-medical-specialist-who-diagnoses-treats-and-prevents-various-conditions-of-skin-hair-and-nails-some-of-the-major-conditions-treated-by-a-gender-dermatologist-include-randomthreediseases-etcppmarham-enlists-almost-doctorscount-best-gender-dermatologists-in-cityph2strongwhat-are-the-diseases-treated-by-a-gender-dermatologist-in-citystrongh2pthe-gender-skin-specialists-in-city-provided-treatment-and-medication-for-all-the-major-conditions-affecting-the-skin-some-commonly-known-issues-that-gender-dermatologists-treat-are-as-followspprandomtendiseaseslistppyou-can-also-book-a-video-consultation-with-the-top-gender-skin-doctors-in-city-to-discuss-the-symptoms-of-skin-hair-or-nail-diseasesph2strongwhat-are-the-services-provided-by-a-gender-dermatologist-in-citystrongh2pgender-dermatologists-offer-the-following-servicespprandomtenserviceslistppadditionally-the-top-gender-skin-specialists-is-city-also-provides-services-such-asppstrongcancer-screeningnbspstrongthe-best-gender-dermatologists-perform-regular-skin-cancer-screenings-to-detect-any-abnormalities-at-earlier-stages-and-provide-necessary-treatmentppstrongeducation-and-preventionnbspstronggender-dermatologists-educate-patients-about-proper-skin-care-and-provide-advice-on-how-to-prevent-various-skin-conditions-they-also-recommend-skin-care-products-that-are-best-suitable-for-an-individualrsquos-skin-typeph2strongbook-an-appointment-with-the-gender-dermatologist-in-citystrongh2pmarham-offers-its-patients-a-range-of-well-known-gender-dermatologists-choose-a-gender-dermatologist-based-on-their-patient-satisfaction-score-qualification-and-fess-book-an-appointment-or-online-consultation-with-the-top-gender-dermatologists-nowplisting-gender-area-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-arealisting-gender-area-page-descriptionplooking-for-a-gender-dermatologist-in-area-city-look-no-further-marham-is-here-to-provide-the-list-of-best-gender-dermatologists-in-area-based-on-their-patientsrsquo-feedback-all-dermatologists-are-experts-in-dealing-with-numerous-health-conditions-dermatologists-in-area-city-are-experts-in-providing-solutions-to-diseases-like-randomthreediseasesppstrongnbspsome-common-problems-that-gender-dermatologists-in-area-city-treat-are-as-followsstrongpprandomtendiseaseslistppstronggender-dermatologists-offer-the-following-services-in-area-citystrongpprandomtenserviceslistppnbspmarham-provides-its-patients-with-a-list-of-famous-gender-dermatologists-in-area-city-choose-a-gender-dermatologist-according-to-their-patient-satisfaction-rate-and-book-an-appointment-or-consult-online-the-list-of-top-gender-dermatologists-based-on-patient-reviews-in-area-city-is-as-followspptopdoctorofspecialitypabout-us-contentbanner-infobanner-urlbanner-imagebanner-status0created-at2019-10-16t043229000000zupdated-at2024-05-16t071033000000zlogohttpsstaticmarhampkassetsimageskiosk70x70dermatologistjpg-islamabad

Dr. Urooj Mirza

Available Today

Rs. 1000

21 Reviews

12+ Years Experience

dr-ali-riaz-spid67specialitydermatologistspeciality-imagedermatologisttitledermatology-cosmetologytitle-2skinslugdermatologistdetailthe-specialists-who-treat-skin-problems-are-called-dermatologists-or-skin-specialistscausesspecialitysoundextrmtljsturdu-nameu0645u0627u06c1u0631-u0627u0645u0631u0627u0636-u062cu0644u062fparent3parent-slugdermatologist-cosmetologistseo-h1doctorscount-best-gender-dermatologist-skin-specialist-in-area-cityseo-h2dermatologist-skin-specialist-city-descriptionseo-titlebest-gender-certified-dermatologist-verified-skin-doctors-in-area-city-marhamseo-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-areaseo-page-descriptionp-styletext-align-justifyabove-is-the-list-of-strongpmc-pakistan-medical-commission-verified-gender-dermatologists-in-citystrong-you-can-view-their-experience-practice-locations-timings-services-fees-and-patient-reviews-you-can-also-find-the-best-dermatologists-in-city-on-the-basis-of-area-fee-gender-and-availability-more-than-doctorscount-top-dermatologists-of-city-are-listed-here-strongbook-an-appointmentstrong-or-strongconsult-onlinestrongph3-styletext-align-justifywho-is-a-dermatologisth3p-styletext-align-justifygender-dermatologists-are-doctors-who-treat-and-diagnose-the-istrongssues-that-affect-our-hair-skinstrong-and-nails-moreover-strongdermatologists-also-deal-with-mucous-membranes-the-tissue-that-lines-your-nose-mouth-and-also-eyelidsstrongph3-styletext-align-justifygender-dermatologists-diagnose-and-treat-the-following-skin-issuesh3ulli-styletext-align-justifystrongacnestronglili-styletext-align-justifyskin-rasheslili-styletext-align-justifydull-complexionlili-styletext-align-justifydiscolorationlili-styletext-align-justifypigmentationlili-styletext-align-justifyvarious-allergies-and-blood-disorders-with-diabeteslili-styletext-align-justifystronghair-fallstronglili-styletext-align-justifystrongdandruffstrongliulp-styletext-align-justifyapart-from-these-issues-stronggender-dermatologistsstrong-also-recognize-and-diagnose-symptoms-of-various-underlying-health-issues-ie-diabetes-has-an-impact-on-the-strongskin-appearancestrong-and-a-dermatologist-might-be-the-first-one-to-diagnose-itpp-styletext-align-justifystrongtheir-work-splits-into-these-three-branchesstrongpulli-styletext-align-justifystrongmedicalstrong-gender-dermatologists-work-on-the-diagnosis-and-treatments-of-the-conditions-that-affect-our-skinlili-styletext-align-justifystrongsurgerystrong-they-also-do-minor-surgeries-to-remove-moles-or-wartslili-styletext-align-justifystrongcosmeticstrong-they-also-deal-with-all-those-issues-that-affect-our-appearances-ie-hair-loss-dark-spots-and-wrinklesliulh3-styletext-align-justifywhen-to-see-a-dermatologisth3p-styletext-align-justifydermatologists-deal-with-various-issues-that-affect-the-skin-hair-or-nails-you-should-visit-a-stronggender-dermatologist-every-six-to-eight-monthsstrong-in-case-you-experience-the-following-symptoms-you-should-see-a-gender-dermatologist-immediatelypulli-styletext-align-justifyskin-rasheslili-styletext-align-justifyskin-irritationburninglili-styletext-align-justifyitchy-and-flaky-skinlili-styletext-align-justifyacnelili-styletext-align-justifystrongskin-blemishesstronglili-styletext-align-justifystrongskin-discolorationstronglili-styletext-align-justifystrongmoles-warts-and-other-growth-on-the-skinstronglili-styletext-align-justifystrongvaricose-veinsstronglili-styletext-align-justifystrongwrinkles-sun-damage-and-sagging-skinstronglili-styletext-align-justifystronghair-damagestronglili-styletext-align-justifyhair-falllili-styletext-align-justifydandrufflili-styletext-align-justifyfingernail-or-toenail-issuesliulh3-styletext-align-justifywhat-issues-are-treated-by-dermatologists-in-cityh3p-styletext-align-justifygender-dermatologists-treat-all-the-health-issues-that-relate-to-our-skin-hair-and-nails-moreover-they-provide-a-wide-range-of-services-and-also-treat-the-following-issuespulli-styletext-align-justifybiopsies-they-do-different-types-of-biopsies-to-diagnose-or-cross-check-the-symptoms-of-skin-cancers-and-other-conditionslili-styletext-align-justifystronglaser-therapystrong-they-use-laser-treatments-to-remove-warts-moles-sun-spots-tattoos-acne-scars-blemishes-wrinkles-and-unwanted-hairlili-styletext-align-justifysurgical-procedures-they-do-surgical-procedures-to-remove-moles-tags-on-the-skin-and-lesionslili-styletext-align-justifysclerotherapy-they-perform-this-procedure-to-treat-spider-and-varicose-veinslili-styletext-align-justifystrongmohs-surgerystrong-this-treatment-removes-a-thin-tissue-layer-around-a-tumorlili-styletext-align-justifychemical-peels-this-procedure-works-wonders-on-our-face-to-remove-the-dead-and-damaged-skinlili-styletext-align-justifystrongcosmetic-injectionsstrong-these-injections-help-diminish-the-wrinkly-and-sagging-skinlili-styletext-align-justifydermabrasion-dermatologists-use-this-technique-to-reduce-the-appearance-of-fine-lines-strongage-spotsstrong-and-strongacne-scarsstronglili-styletext-align-justifytumescent-liposuction-dermatologists-use-liposuction-treatment-for-the-removal-of-unwanted-fat-from-targeted-areas-of-our-bodyliulp-styletext-align-justifyyou-should-strongbook-an-appointment-or-online-consultation-with-the-best-gender-dermatologists-in-citystrong-if-you-face-any-of-the-issues-mentioned-aboveph3-styletext-align-justifywhat-types-of-dermatologists-are-thereh3p-styletext-align-justifyfollowing-are-the-four-main-types-of-gender-dermatologistspulli-styletext-align-justifydermatopathologists-the-ones-who-work-on-the-root-causes-of-the-origin-of-strongvarious-skin-diseasesstronglili-styletext-align-justifystrongpediatric-dermatologistsstrong-these-dermatologists-work-specifically-with-strongskin-issues-in-childrennbspstrongunder-12-years-of-agelili-styletext-align-justifyimmunodermatologists-such-dermatologists-focus-on-examining-how-the-immune-system-interacts-with-our-skin-and-skin-manifestation-of-various-autoimmune-diseaseslili-styletext-align-justifystrongcosmetic-dermatologistsstrong-unlike-immunodermatologists-these-strongtypes-of-dermatologistsstrong-are-the-most-common-ones-that-we-can-find-in-the-field-of-dermatologyliulh3-styletext-align-justifywhat-is-the-qualification-of-a-dermatologisth3p-styletext-align-justifyin-pakistan-stronggender-dermatologistsstrong-are-mbbs-doctors-who-complete-their-five-years-of-study-in-a-medical-college-after-this-gender-dermatologists-become-fellow-of-the-college-of-physicians-and-surgeons-pakistan-fcps-in-their-respective-specialty-all-the-gender-dermatologists-are-pmc-pakistan-medical-commission-verified-however-many-stronggender-dermatologistsstrong-go-on-to-further-specialize-from-abroad-such-as-caaam-d-dermatology-and-othersph3-styletext-align-justifywhat-things-you-should-keep-in-mind-while-selecting-a-dermatologisth3p-styletext-align-justifybefore-choosing-a-gender-dermatologist-you-need-to-think-very-carefully-and-evaluate-your-options-on-the-following-basispulli-styletext-align-justifyexperience-of-the-gender-dermatologistlili-styletext-align-justifyservices-of-the-gender-dermatologist-that-whether-the-gender-dermatologist-provides-the-service-you-are-looking-for-or-notlili-styletext-align-justifyqualifications-of-the-gender-dermatologist-you-should-see-how-qualified-the-gender-dermatologist-islili-styletext-align-justifystrongreviews-of-the-patientsstrong-you-should-read-the-patientrsquos-feedback-this-will-help-you-in-making-an-informed-decision-for-gender-dermatologists-to-seeliulh3-styletext-align-justifywho-are-the-best-gender-dermatologists-in-cityh3p-styletext-align-justifyon-the-basis-of-experience-reviews-and-patients39-feedback-we-have-shortlisted-the-strongtop-five-gender-dermatologists-in-citystrong-their-names-are-as-followspptopdoctorofspecialityph3-styletext-align-justifybook-appointment-or-consult-online-through-marhampkh3p-styletext-align-justifyyou-can-strongbook-an-appointment-or-online-video-consultationstrong-with-the-strongbest-dermatologists-in-city-through-marhampkstrong-pakistanrsquos-no1-healthcare-platform-you-can-book-your-appointment-online-or-call-our-helpline-03111222398-marham-has-so-far-helped-10-million-patients-to-book-their-appointments-with-verified-doctors-we-are-the-largest-service-providing-startup-in-pakistan-stronggoogle-and-facebook-have-awarded-marham-in-recognition-of-its-servicesstrongpp-styletext-align-justifywe-have-registered-the-strongbest-gender-dermatologists-in-citystrong-on-our-platform-now-you-can-avail-the-strongbest-healthcarestrong-with-ease-and-comfort-patients-reviews-practice-details-experience-timing-slots-are-available-to-make-it-easier-for-you-to-strongbook-an-appointmentstrong-you-can-also-consult-online-with-the-strongbest-gender-dermatologists-in-citystrong-and-discuss-your-issues-via-audiostrongvideo-callstrongpp-styletext-align-justifycontent-reviewed-by-a-hrefhttpswwwmarhampkdoctorslahoredermatologistdr-saleha-zeeshandr-saleha-zeeshan-dermatologistapseo-keywordsskin-specialist-skin-doctor-cosmetic-surgeon-aesthetic-physician-cosmetologist-u0645u0627u06c1u0631-u0627u0645u0631u0627u0636-u062cu0644u062fonline-consultation-videohttpswwwyoutubecomwatchv8vapchlro8wposition2redirect-tonullfaqsquestionwhat-is-the-fee-of-a-dermatologist-in-cityanswerpthe-fee-for-a-dermatologist-in-city-generally-ranges-between-rs-strongfeerangestrongpquestionwho-are-the-top-reviewed-dermatologists-in-cityanswerpthe-following-are-the-top-reviewed-dermatologists-in-citypptoprevieweddoctorspquestionwho-are-the-most-experienced-dermatologists-in-cityanswerpthe-following-are-the-most-experienced-dermatologists-in-cityppmostexperienceddoctorspquestionhow-to-book-an-appointment-with-a-dermatologist-in-cityanswerpyou-can-book-an-appointment-with-a-dermatologist-by-visiting-the-doctorrsquos-profile-or-by-calling-our-marham-helpline-at-strong03111222398strongpquestiondo-i-have-to-pay-extra-charges-if-i-book-a-dermatologist-consultation-via-marhampkanswerpno-you-donrsquot-have-to-pay-any-extra-charges-if-you-book-a-dermatologist-consultation-via-marhampkpquestionwhat-are-the-payment-methods-for-online-consultationanswerpyou-can-use-any-of-the-following-payment-methodspullibank-transferlilicredit-cardlilieasy-paisa-or-jazz-cashliulquestiondo-you-have-a-dermatologist-under-1000-in-cityanswerpmarham-has-affordable-dermatologists-whom-you-can-consult-for-under-rs-1000-here39s-the-listpplessthanthousanddoctorspactionsis-pmdc-mandatory-1-is-doctor-prefix-required-1algo-status0algo-updated-at2022-08-17t094603000000zalgo-updated-by639669seo-contentlisting-h1doctorscount-best-dermatologist-in-city-top-skin-specialistslisting-h2what-is-dermatologylisting-titledoctorscount-best-dermatologist-in-city-top-skin-specialist-marhamlisting-area-h1doctorscount-best-gender-dermatologist-in-area-city-top-skin-specialistlisting-area-h2best-dermatologist-in-area-citylisting-gender-h1doctorscount-best-gender-dermatologistskin-specialist-in-area-citylisting-gender-h2gender-dermatologist-in-city-introductionlisting-area-titledoctorscount-best-gender-dermatologist-in-area-city-top-skin-specialist-marhamlisting-gender-titlebest-gender-dermatologist-in-area-city-top-skin-specialist-marhamlisting-gender-area-h1doctorscount-best-gender-dermatologist-skin-specialist-in-area-citylisting-gender-area-h2gender-dermatologist-in-area-city-introductionlisting-meta-descriptionmarham-can-help-you-find-a-dermatologist-in-city-for-your-skin-care-book-an-appointment-with-the-top-skin-specialist-near-you-based-on-their-experience-and-patient-reviewslisting-page-descriptionpa-dermatologist-is-a-medical-doctor-who-specializes-in-medicine-and-further-specializes-in-diagnosing-and-treating-hair-skin-nails-and-mucus-membrane-diseases-some-dermatologists-specializing-in-derma-surgery-are-known-as-dermatologist-surgeonsnbspppthey-are-highly-trained-physicians-who-are-extensively-trained-in-accurately-diagnosing-and-properly-treating-skin-hair-and-nail-related-diseases-they-can-also-manage-cosmetic-disorders-such-as-scars-hair-loss-etcnbspppdermatologists-treat-more-than-3000-skin-hair-and-nail-diseases-as-well-as-cosmetic-concernsnbspph2strongwhat-is-dermatologystrongh2pdermatology-is-the-branch-of-medicine-that-involves-researching-studying-diagnosing-managing-and-treating-conditions-that-affect-the-skin-nails-hair-and-mucus-membranesppit-is-a-specialty-having-both-medical-and-surgical-aspects-the-people-who-study-and-specialize-in-dermatology-and-skin-related-diseases-are-known-as-dermatologistsnbspph2strongalternative-names-for-a-dermatologist-in-citystrongh2psome-of-the-alternative-names-of-a-dermatologist-in-city-are-as-followspulli-dirltrpskin-specialistplili-dirltrpskin-doctorplili-dirltrpcosmetologistplili-dirltrpaesthetic-physicianpliulh2strongwhen-to-see-a-dermatologiststrongh2pyou-should-see-a-dermatologist-to-treat-all-if-you-notice-any-of-the-following-symptoms-or-issuespulli-dirltrpif-you-have-dry-itchy-skin-or-scalpplili-dirltrpif-you-have-any-kind-of-skin-allergiesplili-dirltrpif-you-have-skin-growths-such-as-warts-moles-or-cystsplili-dirltrpif-you-are-facing-hair-damage-or-hair-lossplili-dirltrpif-you-have-any-irregular-skin-growthsplili-dirltrpif-you-have-skin-discolorationplili-dirltrpif-you-have-lesions-or-asymmetrical-molesplili-dirltrpif-you-are-experiencing-frequent-acneplili-dirltrpif-you-are-having-excessive-dandruffplili-dirltrpif-you-are-dealing-with-stubborn-acne-or-acne-marksplili-dirltrpif-you-have-anything-like-nail-abnormalitiesplili-dirltrpif-you-have-unusual-bumps-or-lumps-on-any-part-of-the-skinplili-dirltrpif-you-have-burns-scars-or-acne-marksnbsppliulpif-you-are-facing-any-of-these-conditions-or-any-other-skin-related-issues-then-consult-the-best-dermatologist-in-pakistan-rather-than-ignoring-these-or-doing-any-diysnbspppmoreover-you-can-also-consult-a-dermatologist-if-you-want-any-cosmetic-treatments-to-improve-the-look-tone-and-texture-of-your-skinnbspph2strongwhat-are-the-main-areas-of-concern-for-a-dermatologiststrongh2psome-of-the-main-areas-of-concern-for-a-dermatologist-are-as-followspullidiagnosing-the-skin-hair-or-nails-related-conditionslilitreating-and-managing-those-areas-of-concern-like-eczema-acne-acne-scarsliliprescribing-medicines-ointments-creams-etc-to-overcome-the-derma-issuelilimaking-cosmetic-improvements-to-the-patientrsquos-issue-via-various-procedures-including-chemical-peels-dermabrasion-etcliulh2strongwhat-services-do-dermatologists-providestrongh2phere-are-some-of-the-services-that-a-skin-specialist-can-providepulli-dirltrpstrongdiagnosis-and-treatmentstrongpliulpprofessional-dermatologists-diagnose-and-treat-any-of-the-hair-skin-nails-and-mucus-membrane-diseases-they-perform-thorough-screening-tests-and-diagnosis-to-determine-the-perfect-treatment-for-the-problempulli-dirltrpstrongcosmetic-proceduresstrongpliulpdermatologists-also-perform-various-cosmetic-procedures-including-dermal-fillers-botox-injections-chemical-peels-etcnbsppulli-dirltrpstrongsurgical-proceduresstrongpliulpthey-also-perform-surgical-procedures-to-treat-any-severe-condition-that-cannot-be-treated-with-any-normal-cosmetic-procedures-surgical-procedures-include-skin-biopsy-mole-removal-cyst-removal-etcnbsppulli-dirltrpstrongmanagement-of-chronic-conditionsstrongpliulpdermatologists-also-manage-several-chronic-conditions-including-vitiligo-and-rosaceanbsppulli-dirltrpstronggive-advicestrongpliulpdermatologists-also-provide-advice-on-skincare-routines-products-and-other-diy-things-for-various-skin-conditions-and-typesph2strongwhat-conditions-does-a-dermatologist-treatstrongh2pdermatologists-can-diagnose-and-treat-hundreds-of-conditions-related-to-hair-skin-nails-and-mucus-membranes-includingpulli-dirltrpa-hrefhttpswwwmarhampkall-diseaseseczemastrongeczemastrongastrongnbspstrongpliulpa-nbspdisease-condition-that-makes-your-skin-red-and-itchy-and-is-treated-by-your-dermatologist-using-ointments-and-creamspulli-dirltrpa-hrefhttpswwwmarhampkall-diseasespimplesstrongpimplenbspstrongapliulpthey-are-small-pustules-that-are-raised-on-the-skin-due-to-excessive-sebum-production-and-dust-which-are-routinely-managed-by-a-dermatologist-based-on-the-severity-of-the-skin-conditionpulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesdandruffstrongdandruffstrongapliulpmany-people-around-the-world-face-dandruff-issues-it-causes-the-skin-on-the-scalp-to-flake-it-is-not-a-serious-or-contagious-condition-however-it-is-difficult-to-treat-and-can-be-embarrassingpulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesmelasmastrongmelasmastrongapliulpmelasma-is-a-skin-problem-that-is-caused-by-brown-to-gray-brown-patches-on-the-skin-of-the-face-mostly-it-affects-the-chin-cheeks-nose-bridge-forehead-above-the-upper-lip-etc-it-is-more-common-in-women-as-compared-to-men-the-most-common-cause-of-melasma-is-pregnancynbsppullia-hrefhttpswwwmarhampkall-diseasesskin-cancerstrongskin-cancerstrongaliulpskin-cancer-is-the-uncontrolled-division-of-abnormal-cells-in-the-outermost-layer-of-the-skin-it-is-caused-by-unrepaired-dna-damage-that-triggers-mutation-surgical-dermatologist-treats-skin-cancer-via-surgical-interventions-radiation-therapy-immunotherapy-chemotherapy-etcnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesacnepakistanstrongacnestrongastrongnbspstrongpliulpacne-resulting-from-clogged-hair-follicles-by-oil-dirt-or-dead-cells-is-evaluated-by-a-dermatologist-who-then-prescribes-suitable-topical-remediespulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesingrown-nailsstrongingrown-nailsstrongapliulpingrown-nails-is-the-toe-condition-when-the-corner-of-the-toenail-grows-down-into-the-skin-dermatologists-can-treat-all-nails-related-issues-including-fungal-nails-clubbing-changes-in-the-thickness-of-nails-nail-discoloration-etcpulli-dirltrpa-hrefhttpswwwmarhampkall-serviceshair-restorationlahorestronghair-lossstrongastrongnbspstrongpliulpit-is-a-common-issue-in-young-people-nowadays-and-also-in-older-adults-a-dermatologist-provides-treatment-for-hair-loss-using-injections-medicines-and-laser-therapypulli-dirltrpa-hrefhttpswwwmarhampkall-diseaseswartsstrongwartstrongastrongnbspstrongpliulpyour-skin-doctor-provides-peeling-medicines-or-removes-the-skin-outgrowths-and-moles-through-surgical-excision-they-also-help-to-prevent-fungal-infections-causing-such-conditionspulli-dirltrpa-hrefhttpswwwmarhampkall-diseasespsoriasisstrongpsoriasisstrongastrongstrongpliulppsoriasis-is-an-autoimmune-disease-that-causes-itchy-red-patches-on-the-skin-as-this-disease-is-an-autoimmune-disease-therefore-it-is-chronic-however-dermatologists-can-prescribe-medicines-injections-and-therapies-to-manage-the-symptomsnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-servicesremoval-of-moles-wartsstrongmolesstrongapliulpmoles-are-brown-or-black-growths-on-the-skin-that-are-normally-harmless-and-form-in-childhood-and-adolescence-a-dermatologist-can-remove-moles-by-implementing-surgical-procedures-or-other-treatment-optionsnbsppulli-dirltrpstrongdermatitisnbspstrongpliulpa-dermatologist-treats-red-itchy-rash-and-inflamed-skin-by-prescribing-skin-creams-and-moisturizerspulli-dirltrpstrongathletersquos-foot-tinea-pedisstrongpliulpathletersquos-foot-is-a-fungal-skin-condition-that-begins-between-the-toes-it-is-an-infection-that-causes-white-patches-between-the-toes-skin-specialists-recommend-ointments-tablets-and-creams-to-treat-this-conditionnbspph2strongwhat-are-common-procedures-performed-by-a-dermatologiststrongh2ulli-dirltrpa-hrefhttpswwwmarhampkall-servicesskin-whiteningstrongskin-whiteningstrongapliulpthis-procedure-can-help-to-lighten-dark-spots-and-blemishes-on-the-skin-it-functions-by-reducing-the-production-and-concentration-of-melanin-in-the-skin-it-is-also-used-to-lighten-the-overall-skin-tone-of-a-personnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-servicesrf-for-skin-tighteningstrongskin-tighteningstrongapliulpskin-tightening-can-help-to-reduce-the-appearance-of-wrinkles-and-sagging-skin-it-is-also-used-to-do-face-slimming-and-to-improve-the-skin-elasticitynbsppulli-dirltrpa-hrefhttpswwwmarhampkall-diseasespsoriasisstrongpsoriasis-treatmentstrongapliulpthis-condition-causes-red-scaly-patches-on-the-skin-a-dermatologist-can-prescribe-medications-or-recommend-other-treatments-to-help-manage-psoriasis-certain-ointments-topical-corticosteroids-and-steroid-creams-are-commonly-prescribed-to-treat-mild-to-moderate-psoriasis-this-treatment-functions-by-reducing-inflammation-by-slowing-the-production-of-skin-cells-and-lessening-itchingpulli-dirltrpa-hrefhttpswwwmarhampkspecial-offerslaser-hair-removal-68stronglaser-hair-removalstrongapliulpthis-procedure-can-inhibit-or-delay-the-growth-of-the-unwanted-hair-in-this-procedure-the-laser-is-applied-to-the-area-from-where-you-want-to-remove-any-unwanted-hairnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesrosaceapakistanstrongrosacea-treatmentstrongapliulpthis-condition-causes-redness-flushing-and-pimples-on-the-face-a-dermatologist-can-prescribe-medications-or-recommend-other-treatments-to-help-manage-rosaceapulli-dirltrpa-hrefhttpswwwmarhampkall-servicesdermal-fillerstrongdermal-fillersstrongapliulpdermal-fillers-are-commonly-used-by-cosmetic-facial-surgeons-to-lessen-the-signs-of-aging-minimize-skin-scars-and-depressions-and-treat-fine-lines-and-deep-wrinkles-these-injections-can-fill-in-wrinkles-and-other-facial-folds-they-can-also-be-used-to-fill-in-the-hollow-areas-under-the-eyespulli-dirltrpa-hrefhttpswwwmarhampkall-serviceshair-transplantstronghair-transplantationstrongapliulpthis-procedure-can-be-used-to-restore-hair-loss-for-hair-transplantation-there-are-various-techniques-but-all-hair-transplantations-involve-taking-hair-from-one-part-of-the-scalp-and-grafting-those-hair-onto-bald-or-thin-areas-of-the-scalpppsome-of-the-strongother-proceduresnbspstrongcommonly-performed-by-a-dermatologist-are-as-followspulli-dirltrpchemical-peelsplili-dirltrphydrafacialplili-dirltrpmedicated-facialsplili-dirltrpmicroneedlingplili-dirltrpcryosurgeryplili-dirltrpmohs-surgeryplili-dirltrpmicrodermabrasionpliulh2strongwhat-are-the-most-common-skin-diseases-in-pakistanstrongh2pdermatologists-can-treat-over-em3000nbspemskin-nails-and-hair-related-diseases-the-most-common-ones-are-as-followspulliacne-vulgarisliliscabiesliliimpetigolilieczema-atopic-dermatitisliliseborrheic-dermatitislilifolliculitisliliurticarianbsplilifungal-infections-ringwormlilipsoriasislilivitiligolilimelasmaliliskin-cancerlilitinea-pedis-athletersquos-footliulh2stronghow-to-prepare-for-a-visit-to-a-dermatologiststrongh2pbefore-visiting-a-dermatologist-one-should-keep-the-following-things-in-mindpulli-dirltrpmake-a-list-of-your-issues-and-concerns-or-any-symptoms-that-you-have-noticedplili-dirltrpif-you-have-any-medical-history-then-make-sure-to-keep-the-documents-prescriptions-etcplili-dirltrplist-down-all-the-supplements-medications-or-any-topical-products-that-you-are-usingplili-dirltrpmake-sure-that-your-skin-is-clean-and-free-of-makeupplili-dirltrpdescribe-your-skincare-routine-including-products-and-frequency-of-useplili-dirltrpavoid-wearing-nail-polish-before-visiting-a-dermatologistplili-dirltrpshare-your-family-medical-history-otc-products-etc-with-the-doctorplili-dirltrpwear-comfortable-clothes-so-that-it-is-easy-for-the-doctor-to-access-and-examine-the-affected-skin-areasplili-dirltrpprepare-a-list-of-questions-or-concerns-that-you-want-to-discuss-with-the-dermatologistplili-dirltrptake-pictures-of-the-areas-that-you-cannot-show-to-the-doctor-before-the-visitpliulh2strongwhat-are-some-diagnostic-techniques-used-by-dermatologistsstrongh2pnormally-dermatologists-perform-a-physical-examination-of-the-affected-area-to-diagnose-any-condition-the-doctor-may-prescribe-some-additional-tests-biopsies-skin-cultures-patch-tests-etc-to-accurately-diagnose-the-diseasenbspppsome-of-the-common-diagnostic-methods-performed-and-recommended-by-a-dermatologist-are-as-followspulli-dirltrpstrongvisual-examinationstrongpliulpone-of-the-basic-and-common-ways-of-diagnosing-a-condition-is-the-visual-physical-examination-of-the-affected-area-the-doctor-may-look-for-any-rashes-lesions-lumps-scars-etcnbsppulli-dirltrpstrongskin-culturestrongpliulpthis-test-is-used-to-identify-the-bacteria-or-fungus-that-is-causing-an-infectionpulli-dirltrpstrongskin-biopsystrongpliulpthis-technique-enables-an-in-depth-cellular-level-diagnosis-in-this-procedure-a-small-sample-of-the-skin-tissue-is-removed-and-examined-under-a-microscope-to-diagnose-various-skin-conditions-including-inflammatory-disorders-skin-cancer-and-infectionspulli-dirltrpstrongpatch-teststrongpliulpit-is-used-to-identify-allergies-and-it-applies-minuscule-allergen-amounts-aiding-in-mapping-your-allergenic-profile-it-is-mainly-used-to-diagnose-allergic-contact-dermatitispulli-dirltrpstrongdermoscopystrongpliulpa-non-invasive-procedure-employing-a-specialized-microscope-for-a-thorough-skin-examination-it-is-used-to-assess-blood-vessel-structures-pigmentation-patterns-or-any-other-features-that-are-not-visible-to-the-naked-eyenbsppulli-dirltrpstrongwoodrsquos-lamp-examinationstrongpliulpin-this-method-a-special-ultraviolet-light-woodrsquos-lamp-is-used-to-examine-the-skin-for-pigment-disorders-bacterial-or-fungal-infections-or-any-other-skin-related-conditions-that-fluoresce-under-uv-lightpulli-dirltrpstrongskin-prick-testingstrongpliulpskin-prick-testing-is-a-simple-diagnostic-technique-that-is-performed-to-assess-if-the-person-is-allergic-to-any-substance-like-pollen-or-not-in-this-test-the-skin-is-pricked-with-an-instrument-called-a-lancet-having-a-drop-of-allergen-solution-on-it-the-pricked-site-is-then-observed-for-any-signs-of-allergy-after-10-15-minutesnbspph2strongwhat-are-the-types-of-dermatologistsstrongh2psome-of-the-common-types-of-dermatologists-are-as-followsbrbrpulli-dirltrpstronggeneral-dermatologistsstrongpliulpgeneral-dermatologists-are-the-doctors-who-provide-comprehensive-care-for-a-variety-of-skin-conditions-such-as-eczema-acne-skin-cancer-screenings-psoriasis-athletersquos-foot-and-cosmetic-derma-proceduresnbsppulli-dirltrpstrongcosmetic-dermatologistsstrongpliulpcosmetic-dermatologists-focus-on-improving-the-appearance-of-the-skin-nails-and-hair-using-some-non-invasive-techniques-and-minimally-invasive-procedures-they-perform-treatments-including-dermal-fillers-botox-injections-laser-therapy-chemical-peels-and-cosmetic-surgerypulli-dirltrpstrongdermatopathologistsstrongpliulpdermatopathologists-are-doctors-who-specialize-in-diagnosing-skin-conditions-by-examining-skin-tissue-samples-under-a-microscope-they-play-an-important-role-in-confirming-diagnosis-and-also-guide-treatment-optionsnbsppulli-dirltrpstrongsurgical-dermatologistsstrongpliulpsurgical-dermatologists-are-the-doctors-who-are-experts-in-surgical-procedures-which-are-related-to-dermatological-issuesnbsppulli-dirltrpstrongpediatric-dermatologistsstrongpliulpthey-treat-congenital-genetic-and-acquired-dermatological-issues-that-affect-children-including-toddlers-and-newbornsnbsppulli-dirltrpstrongmohs-surgeonsstrongpliulpmohs-surgeons-are-surgeons-who-specialize-in-mohs-micrographic-surgery-it-is-a-precise-surgical-technique-that-is-used-to-remove-skin-cancer-and-preserve-healthy-tissues-as-much-as-possible-this-is-used-for-skin-cancers-on-the-facial-area-and-other-sensitive-areas-where-tissue-prevention-is-importantnbsppulli-dirltrpstrongmedical-dermatologistsstrongpliulpa-dermatologist-who-specializes-in-diagnosing-treating-and-preventing-diseases-related-to-skin-hair-and-nailsnbspph2stronghow-to-book-an-appointment-with-a-dermatologiststrongh2pyou-can-book-an-appointment-with-a-dermatologist-in-city-through-marham-by-following-these-stepspulli-dirltrpvisit-the-marham-website-or-download-the-marham-appplili-dirltrpsearch-for-quotstrongdermatologiststrongquot-and-specify-your-locationplili-dirltrpbrowse-through-the-list-of-strongdermatologistsnbspstrongavailable-in-your-cityplili-dirltrpselect-the-doctor-you-prefer-based-on-their-profile-reviews-and-fee-rangeplili-dirltrpchoose-a-convenient-date-and-time-for-your-appointmentplili-dirltrpconfirm-your-booking-and-make-any-necessary-payments-through-the-marham-platformplili-dirltrpyou-will-receive-a-confirmation-of-your-appointment-along-with-the-doctor39s-detailspliulh2strongwho-are-the-best-dermatologists-in-citystrongh2pthe-following-is-the-list-of-top-dermatologists-in-citypptopdoctorofspecialityph2strongwhy-choose-marhamstrongh2pthere-are-many-reasons-which-allow-marham-to-stand-apart-from-its-competitors-some-of-them-are-as-followspulli-dirltrpwe-have-approximately-strong48653-reviewsstrong-available-on-the-dermatologist-specialty-to-guide-you-throughout-the-appointment-processplilipyou-can-schedule-strongseamless-appointmentsstrong-with-verified-and-professional-healthcare-providersplili-dirltrpyou-donrsquot-have-to-wait-in-long-lines-you-can-book-strongvideo-consultationsstrong-with-top-doctors-in-pakistanplili-dirltrpwe-have-strongpmc-verified-doctorsstrong-to-provide-you-with-reliable-and-trusted-medical-adviceplili-dirltrpyou-can-ask-questions-from-our-verified-doctors-to-get-personalized-responsesnbspplili-dirltrpyou-can-enjoy-strongpromo-codes-and-special-offersstrong-on-various-doctors-hospitals-surgeries-services-and-labsplili-dirltrpto-ensure-affordable-healthcare-we-offer-strongdiscountsnbspstrongon-labs-online-and-physical-consultationsplili-dirltrpyou-can-book-an-appointment-for-professional-medical-assistance-with-available-doctorsplili-dirltrpour-strong157-customer-supportstrong-is-available-to-assist-and-guide-youplili-dirltrpwe-ensure-strongsecure-online-paymentsstrong-with-ssl-encryptionplili-dirltrpour-strong43-google-star-ratingstrong-speaks-of-our-best-in-class-servicespliulh2strongschedule-an-appointment-with-the-best-dermatologists-in-citystrongh2pmarham-features-a-list-ofstrongnbspdoctorscountstrong-highly-qualified-and-most-experienced-dermatologists-in-cityppbook-an-appointment-or-consult-online-with-a-dermatologist-in-city-by-calling-strong03111222398strong-you-can-choose-a-dermatologist-by-considering-the-doctorrsquos-patient-reviews-expertise-and-practice-location-for-personalized-and-reliable-careplisting-gender-area-titlebest-gender-dermatologist-in-area-city-skin-specialists-marhamlisting-area-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-arealisting-area-page-descriptionpfind-the-best-dermatologist-in-area-city-through-marham-there-are-doctorscount-dermatologists-serving-in-the-area-area-of-city-all-of-them-are-experts-in-dealing-with-various-skin-conditions-skin-specialist-in-area-city-treats-problems-like-randomthreediseases-etcph2strongwhat-are-the-diseases-treated-by-a-dermatologist-in-area-citystrongh2pa-dermatologist-is-a-doctor-who-is-specialized-in-treating-skin-hair-and-nail-conditions-dermatologists-in-area-city-are-well-trained-to-diagnose-treat-and-prevent-conditions-likepprandomtendiseaseslistppconsult-a-skin-specialist-immediately-in-area-city-if-you-have-any-of-these-or-other-skin-issues-that-require-medical-attention-these-skin-specialists-in-area-city-have-extensive-knowledge-and-experience-in-diagnosing-treating-and-managing-diseases-and-cosmetic-concerns-of-the-skinph2strongwhat-are-the-services-provided-by-a-dermatologist-in-area-citystrongh2psome-of-the-dermatological-and-cosmetic-services-provided-by-a-dermatologist-in-area-city-includepprandomtenserviceslistppstrongemread-to-know-more-aboutnbspemstronga-hrefhttpswwwmarhampkhealthblogwhat-does-a-dermatologist-do-relnoopener-noreferrer-target-blankstrongemwhat-a-dermatologist-doemstrongappnbspmarham-provides-its-patients-with-a-list-of-famous-dermatologists-in-area-city-you-can-consult-the-best-skin-specialist-in-area-city-listed-on-marham-for-all-the-a-hrefhttpswwwmarhampkhealthblogreasons-to-see-a-dermatologist-relnoopener-noreferrer-target-blankskin-issuesa-based-on-the-followingpulli-dirltrpstrongdoctorrsquos-feestrong-use-the-fee-range-filter-to-consult-the-most-affordable-dermatologist-according-to-your-choiceplili-dirltrpstrongpatient-reviewsstrong-select-the-dermatologist-in-area-city-based-on-the-patient-reviews-and-the-resulting-patient-satisfaction-scoreplili-dirltrpstrongservices-offeredstrong-select-the-doctor-who-provides-the-required-dermatological-services-according-to-your-requirementspliulpbook-an-appointment-with-the-top-dermatologists-who-are-best-for-skin-problems-in-area-city-nbspbased-on-their-qualifications-experience-and-patient-satisfaction-scorepptopdoctorofspecialityplisting-gender-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-arealisting-gender-page-descriptionpa-gender-dermatologist-is-a-medical-specialist-who-diagnoses-treats-and-prevents-various-conditions-of-skin-hair-and-nails-some-of-the-major-conditions-treated-by-a-gender-dermatologist-include-randomthreediseases-etcppmarham-enlists-almost-doctorscount-best-gender-dermatologists-in-cityph2strongwhat-are-the-diseases-treated-by-a-gender-dermatologist-in-citystrongh2pthe-gender-skin-specialists-in-city-provided-treatment-and-medication-for-all-the-major-conditions-affecting-the-skin-some-commonly-known-issues-that-gender-dermatologists-treat-are-as-followspprandomtendiseaseslistppyou-can-also-book-a-video-consultation-with-the-top-gender-skin-doctors-in-city-to-discuss-the-symptoms-of-skin-hair-or-nail-diseasesph2strongwhat-are-the-services-provided-by-a-gender-dermatologist-in-citystrongh2pgender-dermatologists-offer-the-following-servicespprandomtenserviceslistppadditionally-the-top-gender-skin-specialists-is-city-also-provides-services-such-asppstrongcancer-screeningnbspstrongthe-best-gender-dermatologists-perform-regular-skin-cancer-screenings-to-detect-any-abnormalities-at-earlier-stages-and-provide-necessary-treatmentppstrongeducation-and-preventionnbspstronggender-dermatologists-educate-patients-about-proper-skin-care-and-provide-advice-on-how-to-prevent-various-skin-conditions-they-also-recommend-skin-care-products-that-are-best-suitable-for-an-individualrsquos-skin-typeph2strongbook-an-appointment-with-the-gender-dermatologist-in-citystrongh2pmarham-offers-its-patients-a-range-of-well-known-gender-dermatologists-choose-a-gender-dermatologist-based-on-their-patient-satisfaction-score-qualification-and-fess-book-an-appointment-or-online-consultation-with-the-top-gender-dermatologists-nowplisting-gender-area-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-arealisting-gender-area-page-descriptionplooking-for-a-gender-dermatologist-in-area-city-look-no-further-marham-is-here-to-provide-the-list-of-best-gender-dermatologists-in-area-based-on-their-patientsrsquo-feedback-all-dermatologists-are-experts-in-dealing-with-numerous-health-conditions-dermatologists-in-area-city-are-experts-in-providing-solutions-to-diseases-like-randomthreediseasesppstrongnbspsome-common-problems-that-gender-dermatologists-in-area-city-treat-are-as-followsstrongpprandomtendiseaseslistppstronggender-dermatologists-offer-the-following-services-in-area-citystrongpprandomtenserviceslistppnbspmarham-provides-its-patients-with-a-list-of-famous-gender-dermatologists-in-area-city-choose-a-gender-dermatologist-according-to-their-patient-satisfaction-rate-and-book-an-appointment-or-consult-online-the-list-of-top-gender-dermatologists-based-on-patient-reviews-in-area-city-is-as-followspptopdoctorofspecialitypabout-us-contentbanner-infobanner-urlbanner-imagebanner-status0created-at2019-10-16t043229000000zupdated-at2024-05-16t071033000000zlogohttpsstaticmarhampkassetsimageskiosk70x70dermatologistjpg-islamabad

Dr. Ali Riaz

Available today

Rs. 1000

2 Reviews

10+ Years Experience

dr-zahra-babar-spid67specialitydermatologistspeciality-imagedermatologisttitledermatology-cosmetologytitle-2skinslugdermatologistdetailthe-specialists-who-treat-skin-problems-are-called-dermatologists-or-skin-specialistscausesspecialitysoundextrmtljsturdu-nameu0645u0627u06c1u0631-u0627u0645u0631u0627u0636-u062cu0644u062fparent3parent-slugdermatologist-cosmetologistseo-h1doctorscount-best-gender-dermatologist-skin-specialist-in-area-cityseo-h2dermatologist-skin-specialist-city-descriptionseo-titlebest-gender-certified-dermatologist-verified-skin-doctors-in-area-city-marhamseo-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-areaseo-page-descriptionp-styletext-align-justifyabove-is-the-list-of-strongpmc-pakistan-medical-commission-verified-gender-dermatologists-in-citystrong-you-can-view-their-experience-practice-locations-timings-services-fees-and-patient-reviews-you-can-also-find-the-best-dermatologists-in-city-on-the-basis-of-area-fee-gender-and-availability-more-than-doctorscount-top-dermatologists-of-city-are-listed-here-strongbook-an-appointmentstrong-or-strongconsult-onlinestrongph3-styletext-align-justifywho-is-a-dermatologisth3p-styletext-align-justifygender-dermatologists-are-doctors-who-treat-and-diagnose-the-istrongssues-that-affect-our-hair-skinstrong-and-nails-moreover-strongdermatologists-also-deal-with-mucous-membranes-the-tissue-that-lines-your-nose-mouth-and-also-eyelidsstrongph3-styletext-align-justifygender-dermatologists-diagnose-and-treat-the-following-skin-issuesh3ulli-styletext-align-justifystrongacnestronglili-styletext-align-justifyskin-rasheslili-styletext-align-justifydull-complexionlili-styletext-align-justifydiscolorationlili-styletext-align-justifypigmentationlili-styletext-align-justifyvarious-allergies-and-blood-disorders-with-diabeteslili-styletext-align-justifystronghair-fallstronglili-styletext-align-justifystrongdandruffstrongliulp-styletext-align-justifyapart-from-these-issues-stronggender-dermatologistsstrong-also-recognize-and-diagnose-symptoms-of-various-underlying-health-issues-ie-diabetes-has-an-impact-on-the-strongskin-appearancestrong-and-a-dermatologist-might-be-the-first-one-to-diagnose-itpp-styletext-align-justifystrongtheir-work-splits-into-these-three-branchesstrongpulli-styletext-align-justifystrongmedicalstrong-gender-dermatologists-work-on-the-diagnosis-and-treatments-of-the-conditions-that-affect-our-skinlili-styletext-align-justifystrongsurgerystrong-they-also-do-minor-surgeries-to-remove-moles-or-wartslili-styletext-align-justifystrongcosmeticstrong-they-also-deal-with-all-those-issues-that-affect-our-appearances-ie-hair-loss-dark-spots-and-wrinklesliulh3-styletext-align-justifywhen-to-see-a-dermatologisth3p-styletext-align-justifydermatologists-deal-with-various-issues-that-affect-the-skin-hair-or-nails-you-should-visit-a-stronggender-dermatologist-every-six-to-eight-monthsstrong-in-case-you-experience-the-following-symptoms-you-should-see-a-gender-dermatologist-immediatelypulli-styletext-align-justifyskin-rasheslili-styletext-align-justifyskin-irritationburninglili-styletext-align-justifyitchy-and-flaky-skinlili-styletext-align-justifyacnelili-styletext-align-justifystrongskin-blemishesstronglili-styletext-align-justifystrongskin-discolorationstronglili-styletext-align-justifystrongmoles-warts-and-other-growth-on-the-skinstronglili-styletext-align-justifystrongvaricose-veinsstronglili-styletext-align-justifystrongwrinkles-sun-damage-and-sagging-skinstronglili-styletext-align-justifystronghair-damagestronglili-styletext-align-justifyhair-falllili-styletext-align-justifydandrufflili-styletext-align-justifyfingernail-or-toenail-issuesliulh3-styletext-align-justifywhat-issues-are-treated-by-dermatologists-in-cityh3p-styletext-align-justifygender-dermatologists-treat-all-the-health-issues-that-relate-to-our-skin-hair-and-nails-moreover-they-provide-a-wide-range-of-services-and-also-treat-the-following-issuespulli-styletext-align-justifybiopsies-they-do-different-types-of-biopsies-to-diagnose-or-cross-check-the-symptoms-of-skin-cancers-and-other-conditionslili-styletext-align-justifystronglaser-therapystrong-they-use-laser-treatments-to-remove-warts-moles-sun-spots-tattoos-acne-scars-blemishes-wrinkles-and-unwanted-hairlili-styletext-align-justifysurgical-procedures-they-do-surgical-procedures-to-remove-moles-tags-on-the-skin-and-lesionslili-styletext-align-justifysclerotherapy-they-perform-this-procedure-to-treat-spider-and-varicose-veinslili-styletext-align-justifystrongmohs-surgerystrong-this-treatment-removes-a-thin-tissue-layer-around-a-tumorlili-styletext-align-justifychemical-peels-this-procedure-works-wonders-on-our-face-to-remove-the-dead-and-damaged-skinlili-styletext-align-justifystrongcosmetic-injectionsstrong-these-injections-help-diminish-the-wrinkly-and-sagging-skinlili-styletext-align-justifydermabrasion-dermatologists-use-this-technique-to-reduce-the-appearance-of-fine-lines-strongage-spotsstrong-and-strongacne-scarsstronglili-styletext-align-justifytumescent-liposuction-dermatologists-use-liposuction-treatment-for-the-removal-of-unwanted-fat-from-targeted-areas-of-our-bodyliulp-styletext-align-justifyyou-should-strongbook-an-appointment-or-online-consultation-with-the-best-gender-dermatologists-in-citystrong-if-you-face-any-of-the-issues-mentioned-aboveph3-styletext-align-justifywhat-types-of-dermatologists-are-thereh3p-styletext-align-justifyfollowing-are-the-four-main-types-of-gender-dermatologistspulli-styletext-align-justifydermatopathologists-the-ones-who-work-on-the-root-causes-of-the-origin-of-strongvarious-skin-diseasesstronglili-styletext-align-justifystrongpediatric-dermatologistsstrong-these-dermatologists-work-specifically-with-strongskin-issues-in-childrennbspstrongunder-12-years-of-agelili-styletext-align-justifyimmunodermatologists-such-dermatologists-focus-on-examining-how-the-immune-system-interacts-with-our-skin-and-skin-manifestation-of-various-autoimmune-diseaseslili-styletext-align-justifystrongcosmetic-dermatologistsstrong-unlike-immunodermatologists-these-strongtypes-of-dermatologistsstrong-are-the-most-common-ones-that-we-can-find-in-the-field-of-dermatologyliulh3-styletext-align-justifywhat-is-the-qualification-of-a-dermatologisth3p-styletext-align-justifyin-pakistan-stronggender-dermatologistsstrong-are-mbbs-doctors-who-complete-their-five-years-of-study-in-a-medical-college-after-this-gender-dermatologists-become-fellow-of-the-college-of-physicians-and-surgeons-pakistan-fcps-in-their-respective-specialty-all-the-gender-dermatologists-are-pmc-pakistan-medical-commission-verified-however-many-stronggender-dermatologistsstrong-go-on-to-further-specialize-from-abroad-such-as-caaam-d-dermatology-and-othersph3-styletext-align-justifywhat-things-you-should-keep-in-mind-while-selecting-a-dermatologisth3p-styletext-align-justifybefore-choosing-a-gender-dermatologist-you-need-to-think-very-carefully-and-evaluate-your-options-on-the-following-basispulli-styletext-align-justifyexperience-of-the-gender-dermatologistlili-styletext-align-justifyservices-of-the-gender-dermatologist-that-whether-the-gender-dermatologist-provides-the-service-you-are-looking-for-or-notlili-styletext-align-justifyqualifications-of-the-gender-dermatologist-you-should-see-how-qualified-the-gender-dermatologist-islili-styletext-align-justifystrongreviews-of-the-patientsstrong-you-should-read-the-patientrsquos-feedback-this-will-help-you-in-making-an-informed-decision-for-gender-dermatologists-to-seeliulh3-styletext-align-justifywho-are-the-best-gender-dermatologists-in-cityh3p-styletext-align-justifyon-the-basis-of-experience-reviews-and-patients39-feedback-we-have-shortlisted-the-strongtop-five-gender-dermatologists-in-citystrong-their-names-are-as-followspptopdoctorofspecialityph3-styletext-align-justifybook-appointment-or-consult-online-through-marhampkh3p-styletext-align-justifyyou-can-strongbook-an-appointment-or-online-video-consultationstrong-with-the-strongbest-dermatologists-in-city-through-marhampkstrong-pakistanrsquos-no1-healthcare-platform-you-can-book-your-appointment-online-or-call-our-helpline-03111222398-marham-has-so-far-helped-10-million-patients-to-book-their-appointments-with-verified-doctors-we-are-the-largest-service-providing-startup-in-pakistan-stronggoogle-and-facebook-have-awarded-marham-in-recognition-of-its-servicesstrongpp-styletext-align-justifywe-have-registered-the-strongbest-gender-dermatologists-in-citystrong-on-our-platform-now-you-can-avail-the-strongbest-healthcarestrong-with-ease-and-comfort-patients-reviews-practice-details-experience-timing-slots-are-available-to-make-it-easier-for-you-to-strongbook-an-appointmentstrong-you-can-also-consult-online-with-the-strongbest-gender-dermatologists-in-citystrong-and-discuss-your-issues-via-audiostrongvideo-callstrongpp-styletext-align-justifycontent-reviewed-by-a-hrefhttpswwwmarhampkdoctorslahoredermatologistdr-saleha-zeeshandr-saleha-zeeshan-dermatologistapseo-keywordsskin-specialist-skin-doctor-cosmetic-surgeon-aesthetic-physician-cosmetologist-u0645u0627u06c1u0631-u0627u0645u0631u0627u0636-u062cu0644u062fonline-consultation-videohttpswwwyoutubecomwatchv8vapchlro8wposition2redirect-tonullfaqsquestionwhat-is-the-fee-of-a-dermatologist-in-cityanswerpthe-fee-for-a-dermatologist-in-city-generally-ranges-between-rs-strongfeerangestrongpquestionwho-are-the-top-reviewed-dermatologists-in-cityanswerpthe-following-are-the-top-reviewed-dermatologists-in-citypptoprevieweddoctorspquestionwho-are-the-most-experienced-dermatologists-in-cityanswerpthe-following-are-the-most-experienced-dermatologists-in-cityppmostexperienceddoctorspquestionhow-to-book-an-appointment-with-a-dermatologist-in-cityanswerpyou-can-book-an-appointment-with-a-dermatologist-by-visiting-the-doctorrsquos-profile-or-by-calling-our-marham-helpline-at-strong03111222398strongpquestiondo-i-have-to-pay-extra-charges-if-i-book-a-dermatologist-consultation-via-marhampkanswerpno-you-donrsquot-have-to-pay-any-extra-charges-if-you-book-a-dermatologist-consultation-via-marhampkpquestionwhat-are-the-payment-methods-for-online-consultationanswerpyou-can-use-any-of-the-following-payment-methodspullibank-transferlilicredit-cardlilieasy-paisa-or-jazz-cashliulquestiondo-you-have-a-dermatologist-under-1000-in-cityanswerpmarham-has-affordable-dermatologists-whom-you-can-consult-for-under-rs-1000-here39s-the-listpplessthanthousanddoctorspactionsis-pmdc-mandatory-1-is-doctor-prefix-required-1algo-status0algo-updated-at2022-08-17t094603000000zalgo-updated-by639669seo-contentlisting-h1doctorscount-best-dermatologist-in-city-top-skin-specialistslisting-h2what-is-dermatologylisting-titledoctorscount-best-dermatologist-in-city-top-skin-specialist-marhamlisting-area-h1doctorscount-best-gender-dermatologist-in-area-city-top-skin-specialistlisting-area-h2best-dermatologist-in-area-citylisting-gender-h1doctorscount-best-gender-dermatologistskin-specialist-in-area-citylisting-gender-h2gender-dermatologist-in-city-introductionlisting-area-titledoctorscount-best-gender-dermatologist-in-area-city-top-skin-specialist-marhamlisting-gender-titlebest-gender-dermatologist-in-area-city-top-skin-specialist-marhamlisting-gender-area-h1doctorscount-best-gender-dermatologist-skin-specialist-in-area-citylisting-gender-area-h2gender-dermatologist-in-area-city-introductionlisting-meta-descriptionmarham-can-help-you-find-a-dermatologist-in-city-for-your-skin-care-book-an-appointment-with-the-top-skin-specialist-near-you-based-on-their-experience-and-patient-reviewslisting-page-descriptionpa-dermatologist-is-a-medical-doctor-who-specializes-in-medicine-and-further-specializes-in-diagnosing-and-treating-hair-skin-nails-and-mucus-membrane-diseases-some-dermatologists-specializing-in-derma-surgery-are-known-as-dermatologist-surgeonsnbspppthey-are-highly-trained-physicians-who-are-extensively-trained-in-accurately-diagnosing-and-properly-treating-skin-hair-and-nail-related-diseases-they-can-also-manage-cosmetic-disorders-such-as-scars-hair-loss-etcnbspppdermatologists-treat-more-than-3000-skin-hair-and-nail-diseases-as-well-as-cosmetic-concernsnbspph2strongwhat-is-dermatologystrongh2pdermatology-is-the-branch-of-medicine-that-involves-researching-studying-diagnosing-managing-and-treating-conditions-that-affect-the-skin-nails-hair-and-mucus-membranesppit-is-a-specialty-having-both-medical-and-surgical-aspects-the-people-who-study-and-specialize-in-dermatology-and-skin-related-diseases-are-known-as-dermatologistsnbspph2strongalternative-names-for-a-dermatologist-in-citystrongh2psome-of-the-alternative-names-of-a-dermatologist-in-city-are-as-followspulli-dirltrpskin-specialistplili-dirltrpskin-doctorplili-dirltrpcosmetologistplili-dirltrpaesthetic-physicianpliulh2strongwhen-to-see-a-dermatologiststrongh2pyou-should-see-a-dermatologist-to-treat-all-if-you-notice-any-of-the-following-symptoms-or-issuespulli-dirltrpif-you-have-dry-itchy-skin-or-scalpplili-dirltrpif-you-have-any-kind-of-skin-allergiesplili-dirltrpif-you-have-skin-growths-such-as-warts-moles-or-cystsplili-dirltrpif-you-are-facing-hair-damage-or-hair-lossplili-dirltrpif-you-have-any-irregular-skin-growthsplili-dirltrpif-you-have-skin-discolorationplili-dirltrpif-you-have-lesions-or-asymmetrical-molesplili-dirltrpif-you-are-experiencing-frequent-acneplili-dirltrpif-you-are-having-excessive-dandruffplili-dirltrpif-you-are-dealing-with-stubborn-acne-or-acne-marksplili-dirltrpif-you-have-anything-like-nail-abnormalitiesplili-dirltrpif-you-have-unusual-bumps-or-lumps-on-any-part-of-the-skinplili-dirltrpif-you-have-burns-scars-or-acne-marksnbsppliulpif-you-are-facing-any-of-these-conditions-or-any-other-skin-related-issues-then-consult-the-best-dermatologist-in-pakistan-rather-than-ignoring-these-or-doing-any-diysnbspppmoreover-you-can-also-consult-a-dermatologist-if-you-want-any-cosmetic-treatments-to-improve-the-look-tone-and-texture-of-your-skinnbspph2strongwhat-are-the-main-areas-of-concern-for-a-dermatologiststrongh2psome-of-the-main-areas-of-concern-for-a-dermatologist-are-as-followspullidiagnosing-the-skin-hair-or-nails-related-conditionslilitreating-and-managing-those-areas-of-concern-like-eczema-acne-acne-scarsliliprescribing-medicines-ointments-creams-etc-to-overcome-the-derma-issuelilimaking-cosmetic-improvements-to-the-patientrsquos-issue-via-various-procedures-including-chemical-peels-dermabrasion-etcliulh2strongwhat-services-do-dermatologists-providestrongh2phere-are-some-of-the-services-that-a-skin-specialist-can-providepulli-dirltrpstrongdiagnosis-and-treatmentstrongpliulpprofessional-dermatologists-diagnose-and-treat-any-of-the-hair-skin-nails-and-mucus-membrane-diseases-they-perform-thorough-screening-tests-and-diagnosis-to-determine-the-perfect-treatment-for-the-problempulli-dirltrpstrongcosmetic-proceduresstrongpliulpdermatologists-also-perform-various-cosmetic-procedures-including-dermal-fillers-botox-injections-chemical-peels-etcnbsppulli-dirltrpstrongsurgical-proceduresstrongpliulpthey-also-perform-surgical-procedures-to-treat-any-severe-condition-that-cannot-be-treated-with-any-normal-cosmetic-procedures-surgical-procedures-include-skin-biopsy-mole-removal-cyst-removal-etcnbsppulli-dirltrpstrongmanagement-of-chronic-conditionsstrongpliulpdermatologists-also-manage-several-chronic-conditions-including-vitiligo-and-rosaceanbsppulli-dirltrpstronggive-advicestrongpliulpdermatologists-also-provide-advice-on-skincare-routines-products-and-other-diy-things-for-various-skin-conditions-and-typesph2strongwhat-conditions-does-a-dermatologist-treatstrongh2pdermatologists-can-diagnose-and-treat-hundreds-of-conditions-related-to-hair-skin-nails-and-mucus-membranes-includingpulli-dirltrpa-hrefhttpswwwmarhampkall-diseaseseczemastrongeczemastrongastrongnbspstrongpliulpa-nbspdisease-condition-that-makes-your-skin-red-and-itchy-and-is-treated-by-your-dermatologist-using-ointments-and-creamspulli-dirltrpa-hrefhttpswwwmarhampkall-diseasespimplesstrongpimplenbspstrongapliulpthey-are-small-pustules-that-are-raised-on-the-skin-due-to-excessive-sebum-production-and-dust-which-are-routinely-managed-by-a-dermatologist-based-on-the-severity-of-the-skin-conditionpulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesdandruffstrongdandruffstrongapliulpmany-people-around-the-world-face-dandruff-issues-it-causes-the-skin-on-the-scalp-to-flake-it-is-not-a-serious-or-contagious-condition-however-it-is-difficult-to-treat-and-can-be-embarrassingpulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesmelasmastrongmelasmastrongapliulpmelasma-is-a-skin-problem-that-is-caused-by-brown-to-gray-brown-patches-on-the-skin-of-the-face-mostly-it-affects-the-chin-cheeks-nose-bridge-forehead-above-the-upper-lip-etc-it-is-more-common-in-women-as-compared-to-men-the-most-common-cause-of-melasma-is-pregnancynbsppullia-hrefhttpswwwmarhampkall-diseasesskin-cancerstrongskin-cancerstrongaliulpskin-cancer-is-the-uncontrolled-division-of-abnormal-cells-in-the-outermost-layer-of-the-skin-it-is-caused-by-unrepaired-dna-damage-that-triggers-mutation-surgical-dermatologist-treats-skin-cancer-via-surgical-interventions-radiation-therapy-immunotherapy-chemotherapy-etcnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesacnepakistanstrongacnestrongastrongnbspstrongpliulpacne-resulting-from-clogged-hair-follicles-by-oil-dirt-or-dead-cells-is-evaluated-by-a-dermatologist-who-then-prescribes-suitable-topical-remediespulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesingrown-nailsstrongingrown-nailsstrongapliulpingrown-nails-is-the-toe-condition-when-the-corner-of-the-toenail-grows-down-into-the-skin-dermatologists-can-treat-all-nails-related-issues-including-fungal-nails-clubbing-changes-in-the-thickness-of-nails-nail-discoloration-etcpulli-dirltrpa-hrefhttpswwwmarhampkall-serviceshair-restorationlahorestronghair-lossstrongastrongnbspstrongpliulpit-is-a-common-issue-in-young-people-nowadays-and-also-in-older-adults-a-dermatologist-provides-treatment-for-hair-loss-using-injections-medicines-and-laser-therapypulli-dirltrpa-hrefhttpswwwmarhampkall-diseaseswartsstrongwartstrongastrongnbspstrongpliulpyour-skin-doctor-provides-peeling-medicines-or-removes-the-skin-outgrowths-and-moles-through-surgical-excision-they-also-help-to-prevent-fungal-infections-causing-such-conditionspulli-dirltrpa-hrefhttpswwwmarhampkall-diseasespsoriasisstrongpsoriasisstrongastrongstrongpliulppsoriasis-is-an-autoimmune-disease-that-causes-itchy-red-patches-on-the-skin-as-this-disease-is-an-autoimmune-disease-therefore-it-is-chronic-however-dermatologists-can-prescribe-medicines-injections-and-therapies-to-manage-the-symptomsnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-servicesremoval-of-moles-wartsstrongmolesstrongapliulpmoles-are-brown-or-black-growths-on-the-skin-that-are-normally-harmless-and-form-in-childhood-and-adolescence-a-dermatologist-can-remove-moles-by-implementing-surgical-procedures-or-other-treatment-optionsnbsppulli-dirltrpstrongdermatitisnbspstrongpliulpa-dermatologist-treats-red-itchy-rash-and-inflamed-skin-by-prescribing-skin-creams-and-moisturizerspulli-dirltrpstrongathletersquos-foot-tinea-pedisstrongpliulpathletersquos-foot-is-a-fungal-skin-condition-that-begins-between-the-toes-it-is-an-infection-that-causes-white-patches-between-the-toes-skin-specialists-recommend-ointments-tablets-and-creams-to-treat-this-conditionnbspph2strongwhat-are-common-procedures-performed-by-a-dermatologiststrongh2ulli-dirltrpa-hrefhttpswwwmarhampkall-servicesskin-whiteningstrongskin-whiteningstrongapliulpthis-procedure-can-help-to-lighten-dark-spots-and-blemishes-on-the-skin-it-functions-by-reducing-the-production-and-concentration-of-melanin-in-the-skin-it-is-also-used-to-lighten-the-overall-skin-tone-of-a-personnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-servicesrf-for-skin-tighteningstrongskin-tighteningstrongapliulpskin-tightening-can-help-to-reduce-the-appearance-of-wrinkles-and-sagging-skin-it-is-also-used-to-do-face-slimming-and-to-improve-the-skin-elasticitynbsppulli-dirltrpa-hrefhttpswwwmarhampkall-diseasespsoriasisstrongpsoriasis-treatmentstrongapliulpthis-condition-causes-red-scaly-patches-on-the-skin-a-dermatologist-can-prescribe-medications-or-recommend-other-treatments-to-help-manage-psoriasis-certain-ointments-topical-corticosteroids-and-steroid-creams-are-commonly-prescribed-to-treat-mild-to-moderate-psoriasis-this-treatment-functions-by-reducing-inflammation-by-slowing-the-production-of-skin-cells-and-lessening-itchingpulli-dirltrpa-hrefhttpswwwmarhampkspecial-offerslaser-hair-removal-68stronglaser-hair-removalstrongapliulpthis-procedure-can-inhibit-or-delay-the-growth-of-the-unwanted-hair-in-this-procedure-the-laser-is-applied-to-the-area-from-where-you-want-to-remove-any-unwanted-hairnbsppulli-dirltrpa-hrefhttpswwwmarhampkall-diseasesrosaceapakistanstrongrosacea-treatmentstrongapliulpthis-condition-causes-redness-flushing-and-pimples-on-the-face-a-dermatologist-can-prescribe-medications-or-recommend-other-treatments-to-help-manage-rosaceapulli-dirltrpa-hrefhttpswwwmarhampkall-servicesdermal-fillerstrongdermal-fillersstrongapliulpdermal-fillers-are-commonly-used-by-cosmetic-facial-surgeons-to-lessen-the-signs-of-aging-minimize-skin-scars-and-depressions-and-treat-fine-lines-and-deep-wrinkles-these-injections-can-fill-in-wrinkles-and-other-facial-folds-they-can-also-be-used-to-fill-in-the-hollow-areas-under-the-eyespulli-dirltrpa-hrefhttpswwwmarhampkall-serviceshair-transplantstronghair-transplantationstrongapliulpthis-procedure-can-be-used-to-restore-hair-loss-for-hair-transplantation-there-are-various-techniques-but-all-hair-transplantations-involve-taking-hair-from-one-part-of-the-scalp-and-grafting-those-hair-onto-bald-or-thin-areas-of-the-scalpppsome-of-the-strongother-proceduresnbspstrongcommonly-performed-by-a-dermatologist-are-as-followspulli-dirltrpchemical-peelsplili-dirltrphydrafacialplili-dirltrpmedicated-facialsplili-dirltrpmicroneedlingplili-dirltrpcryosurgeryplili-dirltrpmohs-surgeryplili-dirltrpmicrodermabrasionpliulh2strongwhat-are-the-most-common-skin-diseases-in-pakistanstrongh2pdermatologists-can-treat-over-em3000nbspemskin-nails-and-hair-related-diseases-the-most-common-ones-are-as-followspulliacne-vulgarisliliscabiesliliimpetigolilieczema-atopic-dermatitisliliseborrheic-dermatitislilifolliculitisliliurticarianbsplilifungal-infections-ringwormlilipsoriasislilivitiligolilimelasmaliliskin-cancerlilitinea-pedis-athletersquos-footliulh2stronghow-to-prepare-for-a-visit-to-a-dermatologiststrongh2pbefore-visiting-a-dermatologist-one-should-keep-the-following-things-in-mindpulli-dirltrpmake-a-list-of-your-issues-and-concerns-or-any-symptoms-that-you-have-noticedplili-dirltrpif-you-have-any-medical-history-then-make-sure-to-keep-the-documents-prescriptions-etcplili-dirltrplist-down-all-the-supplements-medications-or-any-topical-products-that-you-are-usingplili-dirltrpmake-sure-that-your-skin-is-clean-and-free-of-makeupplili-dirltrpdescribe-your-skincare-routine-including-products-and-frequency-of-useplili-dirltrpavoid-wearing-nail-polish-before-visiting-a-dermatologistplili-dirltrpshare-your-family-medical-history-otc-products-etc-with-the-doctorplili-dirltrpwear-comfortable-clothes-so-that-it-is-easy-for-the-doctor-to-access-and-examine-the-affected-skin-areasplili-dirltrpprepare-a-list-of-questions-or-concerns-that-you-want-to-discuss-with-the-dermatologistplili-dirltrptake-pictures-of-the-areas-that-you-cannot-show-to-the-doctor-before-the-visitpliulh2strongwhat-are-some-diagnostic-techniques-used-by-dermatologistsstrongh2pnormally-dermatologists-perform-a-physical-examination-of-the-affected-area-to-diagnose-any-condition-the-doctor-may-prescribe-some-additional-tests-biopsies-skin-cultures-patch-tests-etc-to-accurately-diagnose-the-diseasenbspppsome-of-the-common-diagnostic-methods-performed-and-recommended-by-a-dermatologist-are-as-followspulli-dirltrpstrongvisual-examinationstrongpliulpone-of-the-basic-and-common-ways-of-diagnosing-a-condition-is-the-visual-physical-examination-of-the-affected-area-the-doctor-may-look-for-any-rashes-lesions-lumps-scars-etcnbsppulli-dirltrpstrongskin-culturestrongpliulpthis-test-is-used-to-identify-the-bacteria-or-fungus-that-is-causing-an-infectionpulli-dirltrpstrongskin-biopsystrongpliulpthis-technique-enables-an-in-depth-cellular-level-diagnosis-in-this-procedure-a-small-sample-of-the-skin-tissue-is-removed-and-examined-under-a-microscope-to-diagnose-various-skin-conditions-including-inflammatory-disorders-skin-cancer-and-infectionspulli-dirltrpstrongpatch-teststrongpliulpit-is-used-to-identify-allergies-and-it-applies-minuscule-allergen-amounts-aiding-in-mapping-your-allergenic-profile-it-is-mainly-used-to-diagnose-allergic-contact-dermatitispulli-dirltrpstrongdermoscopystrongpliulpa-non-invasive-procedure-employing-a-specialized-microscope-for-a-thorough-skin-examination-it-is-used-to-assess-blood-vessel-structures-pigmentation-patterns-or-any-other-features-that-are-not-visible-to-the-naked-eyenbsppulli-dirltrpstrongwoodrsquos-lamp-examinationstrongpliulpin-this-method-a-special-ultraviolet-light-woodrsquos-lamp-is-used-to-examine-the-skin-for-pigment-disorders-bacterial-or-fungal-infections-or-any-other-skin-related-conditions-that-fluoresce-under-uv-lightpulli-dirltrpstrongskin-prick-testingstrongpliulpskin-prick-testing-is-a-simple-diagnostic-technique-that-is-performed-to-assess-if-the-person-is-allergic-to-any-substance-like-pollen-or-not-in-this-test-the-skin-is-pricked-with-an-instrument-called-a-lancet-having-a-drop-of-allergen-solution-on-it-the-pricked-site-is-then-observed-for-any-signs-of-allergy-after-10-15-minutesnbspph2strongwhat-are-the-types-of-dermatologistsstrongh2psome-of-the-common-types-of-dermatologists-are-as-followsbrbrpulli-dirltrpstronggeneral-dermatologistsstrongpliulpgeneral-dermatologists-are-the-doctors-who-provide-comprehensive-care-for-a-variety-of-skin-conditions-such-as-eczema-acne-skin-cancer-screenings-psoriasis-athletersquos-foot-and-cosmetic-derma-proceduresnbsppulli-dirltrpstrongcosmetic-dermatologistsstrongpliulpcosmetic-dermatologists-focus-on-improving-the-appearance-of-the-skin-nails-and-hair-using-some-non-invasive-techniques-and-minimally-invasive-procedures-they-perform-treatments-including-dermal-fillers-botox-injections-laser-therapy-chemical-peels-and-cosmetic-surgerypulli-dirltrpstrongdermatopathologistsstrongpliulpdermatopathologists-are-doctors-who-specialize-in-diagnosing-skin-conditions-by-examining-skin-tissue-samples-under-a-microscope-they-play-an-important-role-in-confirming-diagnosis-and-also-guide-treatment-optionsnbsppulli-dirltrpstrongsurgical-dermatologistsstrongpliulpsurgical-dermatologists-are-the-doctors-who-are-experts-in-surgical-procedures-which-are-related-to-dermatological-issuesnbsppulli-dirltrpstrongpediatric-dermatologistsstrongpliulpthey-treat-congenital-genetic-and-acquired-dermatological-issues-that-affect-children-including-toddlers-and-newbornsnbsppulli-dirltrpstrongmohs-surgeonsstrongpliulpmohs-surgeons-are-surgeons-who-specialize-in-mohs-micrographic-surgery-it-is-a-precise-surgical-technique-that-is-used-to-remove-skin-cancer-and-preserve-healthy-tissues-as-much-as-possible-this-is-used-for-skin-cancers-on-the-facial-area-and-other-sensitive-areas-where-tissue-prevention-is-importantnbsppulli-dirltrpstrongmedical-dermatologistsstrongpliulpa-dermatologist-who-specializes-in-diagnosing-treating-and-preventing-diseases-related-to-skin-hair-and-nailsnbspph2stronghow-to-book-an-appointment-with-a-dermatologiststrongh2pyou-can-book-an-appointment-with-a-dermatologist-in-city-through-marham-by-following-these-stepspulli-dirltrpvisit-the-marham-website-or-download-the-marham-appplili-dirltrpsearch-for-quotstrongdermatologiststrongquot-and-specify-your-locationplili-dirltrpbrowse-through-the-list-of-strongdermatologistsnbspstrongavailable-in-your-cityplili-dirltrpselect-the-doctor-you-prefer-based-on-their-profile-reviews-and-fee-rangeplili-dirltrpchoose-a-convenient-date-and-time-for-your-appointmentplili-dirltrpconfirm-your-booking-and-make-any-necessary-payments-through-the-marham-platformplili-dirltrpyou-will-receive-a-confirmation-of-your-appointment-along-with-the-doctor39s-detailspliulh2strongwho-are-the-best-dermatologists-in-citystrongh2pthe-following-is-the-list-of-top-dermatologists-in-citypptopdoctorofspecialityph2strongwhy-choose-marhamstrongh2pthere-are-many-reasons-which-allow-marham-to-stand-apart-from-its-competitors-some-of-them-are-as-followspulli-dirltrpwe-have-approximately-strong48653-reviewsstrong-available-on-the-dermatologist-specialty-to-guide-you-throughout-the-appointment-processplilipyou-can-schedule-strongseamless-appointmentsstrong-with-verified-and-professional-healthcare-providersplili-dirltrpyou-donrsquot-have-to-wait-in-long-lines-you-can-book-strongvideo-consultationsstrong-with-top-doctors-in-pakistanplili-dirltrpwe-have-strongpmc-verified-doctorsstrong-to-provide-you-with-reliable-and-trusted-medical-adviceplili-dirltrpyou-can-ask-questions-from-our-verified-doctors-to-get-personalized-responsesnbspplili-dirltrpyou-can-enjoy-strongpromo-codes-and-special-offersstrong-on-various-doctors-hospitals-surgeries-services-and-labsplili-dirltrpto-ensure-affordable-healthcare-we-offer-strongdiscountsnbspstrongon-labs-online-and-physical-consultationsplili-dirltrpyou-can-book-an-appointment-for-professional-medical-assistance-with-available-doctorsplili-dirltrpour-strong157-customer-supportstrong-is-available-to-assist-and-guide-youplili-dirltrpwe-ensure-strongsecure-online-paymentsstrong-with-ssl-encryptionplili-dirltrpour-strong43-google-star-ratingstrong-speaks-of-our-best-in-class-servicespliulh2strongschedule-an-appointment-with-the-best-dermatologists-in-citystrongh2pmarham-features-a-list-ofstrongnbspdoctorscountstrong-highly-qualified-and-most-experienced-dermatologists-in-cityppbook-an-appointment-or-consult-online-with-a-dermatologist-in-city-by-calling-strong03111222398strong-you-can-choose-a-dermatologist-by-considering-the-doctorrsquos-patient-reviews-expertise-and-practice-location-for-personalized-and-reliable-careplisting-gender-area-titlebest-gender-dermatologist-in-area-city-skin-specialists-marhamlisting-area-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-arealisting-area-page-descriptionpfind-the-best-dermatologist-in-area-city-through-marham-there-are-doctorscount-dermatologists-serving-in-the-area-area-of-city-all-of-them-are-experts-in-dealing-with-various-skin-conditions-skin-specialist-in-area-city-treats-problems-like-randomthreediseases-etcph2strongwhat-are-the-diseases-treated-by-a-dermatologist-in-area-citystrongh2pa-dermatologist-is-a-doctor-who-is-specialized-in-treating-skin-hair-and-nail-conditions-dermatologists-in-area-city-are-well-trained-to-diagnose-treat-and-prevent-conditions-likepprandomtendiseaseslistppconsult-a-skin-specialist-immediately-in-area-city-if-you-have-any-of-these-or-other-skin-issues-that-require-medical-attention-these-skin-specialists-in-area-city-have-extensive-knowledge-and-experience-in-diagnosing-treating-and-managing-diseases-and-cosmetic-concerns-of-the-skinph2strongwhat-are-the-services-provided-by-a-dermatologist-in-area-citystrongh2psome-of-the-dermatological-and-cosmetic-services-provided-by-a-dermatologist-in-area-city-includepprandomtenserviceslistppstrongemread-to-know-more-aboutnbspemstronga-hrefhttpswwwmarhampkhealthblogwhat-does-a-dermatologist-do-relnoopener-noreferrer-target-blankstrongemwhat-a-dermatologist-doemstrongappnbspmarham-provides-its-patients-with-a-list-of-famous-dermatologists-in-area-city-you-can-consult-the-best-skin-specialist-in-area-city-listed-on-marham-for-all-the-a-hrefhttpswwwmarhampkhealthblogreasons-to-see-a-dermatologist-relnoopener-noreferrer-target-blankskin-issuesa-based-on-the-followingpulli-dirltrpstrongdoctorrsquos-feestrong-use-the-fee-range-filter-to-consult-the-most-affordable-dermatologist-according-to-your-choiceplili-dirltrpstrongpatient-reviewsstrong-select-the-dermatologist-in-area-city-based-on-the-patient-reviews-and-the-resulting-patient-satisfaction-scoreplili-dirltrpstrongservices-offeredstrong-select-the-doctor-who-provides-the-required-dermatological-services-according-to-your-requirementspliulpbook-an-appointment-with-the-top-dermatologists-who-are-best-for-skin-problems-in-area-city-nbspbased-on-their-qualifications-experience-and-patient-satisfaction-scorepptopdoctorofspecialityplisting-gender-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-arealisting-gender-page-descriptionpa-gender-dermatologist-is-a-medical-specialist-who-diagnoses-treats-and-prevents-various-conditions-of-skin-hair-and-nails-some-of-the-major-conditions-treated-by-a-gender-dermatologist-include-randomthreediseases-etcppmarham-enlists-almost-doctorscount-best-gender-dermatologists-in-cityph2strongwhat-are-the-diseases-treated-by-a-gender-dermatologist-in-citystrongh2pthe-gender-skin-specialists-in-city-provided-treatment-and-medication-for-all-the-major-conditions-affecting-the-skin-some-commonly-known-issues-that-gender-dermatologists-treat-are-as-followspprandomtendiseaseslistppyou-can-also-book-a-video-consultation-with-the-top-gender-skin-doctors-in-city-to-discuss-the-symptoms-of-skin-hair-or-nail-diseasesph2strongwhat-are-the-services-provided-by-a-gender-dermatologist-in-citystrongh2pgender-dermatologists-offer-the-following-servicespprandomtenserviceslistppadditionally-the-top-gender-skin-specialists-is-city-also-provides-services-such-asppstrongcancer-screeningnbspstrongthe-best-gender-dermatologists-perform-regular-skin-cancer-screenings-to-detect-any-abnormalities-at-earlier-stages-and-provide-necessary-treatmentppstrongeducation-and-preventionnbspstronggender-dermatologists-educate-patients-about-proper-skin-care-and-provide-advice-on-how-to-prevent-various-skin-conditions-they-also-recommend-skin-care-products-that-are-best-suitable-for-an-individualrsquos-skin-typeph2strongbook-an-appointment-with-the-gender-dermatologist-in-citystrongh2pmarham-offers-its-patients-a-range-of-well-known-gender-dermatologists-choose-a-gender-dermatologist-based-on-their-patient-satisfaction-score-qualification-and-fess-book-an-appointment-or-online-consultation-with-the-top-gender-dermatologists-nowplisting-gender-area-meta-descriptionconsult-with-the-best-gender-dermatologists-skin-specialist-in-area-city-through-online-appointment-read-unbiased-patient-reviews-to-find-top-skin-doctors-in-your-arealisting-gender-area-page-descriptionplooking-for-a-gender-dermatologist-in-area-city-look-no-further-marham-is-here-to-provide-the-list-of-best-gender-dermatologists-in-area-based-on-their-patientsrsquo-feedback-all-dermatologists-are-experts-in-dealing-with-numerous-health-conditions-dermatologists-in-area-city-are-experts-in-providing-solutions-to-diseases-like-randomthreediseasesppstrongnbspsome-common-problems-that-gender-dermatologists-in-area-city-treat-are-as-followsstrongpprandomtendiseaseslistppstronggender-dermatologists-offer-the-following-services-in-area-citystrongpprandomtenserviceslistppnbspmarham-provides-its-patients-with-a-list-of-famous-gender-dermatologists-in-area-city-choose-a-gender-dermatologist-according-to-their-patient-satisfaction-rate-and-book-an-appointment-or-consult-online-the-list-of-top-gender-dermatologists-based-on-patient-reviews-in-area-city-is-as-followspptopdoctorofspecialitypabout-us-contentbanner-infobanner-urlbanner-imagebanner-status0created-at2019-10-16t043229000000zupdated-at2024-05-16t071033000000zlogohttpsstaticmarhampkassetsimageskiosk70x70dermatologistjpg-islamabad

Dr. Zahra Babar

Available Today

Rs. 1000

3 Reviews

5+ Years Experience